PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G14020.1 | ||||||||
Common Name | MDC16.15, NFYA6, NF-YA6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 308aa MW: 34433.5 Da PI: 9.9528 | ||||||||
Description | nuclear factor Y, subunit A6 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 101.1 | 1.1e-31 | 170 | 226 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQyq+Il+RR++Rakle+++kl +k rkpylheSRh hAl+R RgsgGrF AT3G14020.1 170 NEPIFVNAKQYQAILRRRERRAKLEAQNKL-IKVRKPYLHESRHLHALKRVRGSGGRF 226 59****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.0E-35 | 168 | 229 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.271 | 169 | 229 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.7E-26 | 171 | 226 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 3.2E-22 | 172 | 194 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 174 | 194 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 3.2E-22 | 203 | 226 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 308 aa Download sequence Send to blast |
MQEFHSSKDS LPCPATSWDN SVFTNSNVQG SSSLTDNNTL SLTMEMKQTG FQMQHYDSSS 60 TQSTGGESYS EVASLSEPTN RYGHNIVVTH LSGYKENPEN PIGSHSISKV SQDSVVLPIE 120 AASWPLHGNV TPHFNGFLSF PYASQHTVQH PQIRGLVPSR MPLPHNIPEN EPIFVNAKQY 180 QAILRRRERR AKLEAQNKLI KVRKPYLHES RHLHALKRVR GSGGRFLNTK KHQESNSSLS 240 PPFLIPPHVF KNSPGKFRQM DISRGGVVSS VSTTSCSDIT GNNNDMFQQN PQFRFSGYPS 300 NHHVSVLM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 6e-18 | 171 | 241 | 3 | 77 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 334185332 | 0.0 | ||||
Genevisible | 258198_at | 0.0 | ||||
Expression Atlas | AT3G14020 | - | ||||
AtGenExpress | AT3G14020 | - | ||||
ATTED-II | AT3G14020 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G14020.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT5G47640, AT1G54830 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G14020 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493613 | 0.0 | AB493613.1 Arabidopsis thaliana At3g14020 mRNA for hypothetical protein, partial cds, clone: RAAt3g14020. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001327488.1 | 0.0 | nuclear factor Y, subunit A6 | ||||
Refseq | NP_188018.1 | 0.0 | nuclear factor Y, subunit A6 | ||||
Swissprot | Q9LVJ7 | 0.0 | NFYA6_ARATH; Nuclear transcription factor Y subunit A-6 | ||||
TrEMBL | A0A178V9U2 | 0.0 | A0A178V9U2_ARATH; NF-YA6 | ||||
STRING | AT3G14020.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14733 | 16 | 20 | Representative plant | OGRP680 | 16 | 72 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G14020.1 |
Entrez Gene | 820616 |
iHOP | AT3G14020 |
wikigenes | AT3G14020 |