PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS760789.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 165aa MW: 18741.2 Da PI: 8.5918 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 123.2 | 2.3e-38 | 8 | 125 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 lppGfrF Ptdeelvv++L++k++ +++ +vi+++++y ++Pw+L+ k+ +e ++wyfFs++ + r+t +gyWk g ++v+++++ EcS760789.10 8 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLELYPYDPWELEGKALSEGNKWYFFSRK--------TPDRITGNGYWKPMGD-EPVFTSSS 94 79*************************999.99***************77778899*****997........4689**********98.67777799 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + vg+k++Lv+y g+ap g++t+W+mheyrl EcS760789.10 95 KRVGMKQSLVYYLGEAPGGTRTNWIMHEYRL 125 9****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.35E-46 | 5 | 132 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 41.634 | 8 | 141 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.0E-24 | 9 | 125 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MGDNNVNLPP GFRFYPTDEE LVVHFLQRKA ALLPCHPDVI PDLELYPYDP WELEGKALSE 60 GNKWYFFSRK TPDRITGNGY WKPMGDEPVF TSSSKRVGMK QSLVYYLGEA PGGTRTNWIM 120 HEYRLSNGTN SGSSSSRSSK RKGYPKIVCL SSPIYYYTVG LDTLP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 2e-42 | 4 | 135 | 16 | 155 | NAC domain-containing protein 19 |
3swm_B | 2e-42 | 4 | 135 | 16 | 155 | NAC domain-containing protein 19 |
3swm_C | 2e-42 | 4 | 135 | 16 | 155 | NAC domain-containing protein 19 |
3swm_D | 2e-42 | 4 | 135 | 16 | 155 | NAC domain-containing protein 19 |
3swp_A | 2e-42 | 4 | 135 | 16 | 155 | NAC domain-containing protein 19 |
3swp_B | 2e-42 | 4 | 135 | 16 | 155 | NAC domain-containing protein 19 |
3swp_C | 2e-42 | 4 | 135 | 16 | 155 | NAC domain-containing protein 19 |
3swp_D | 2e-42 | 4 | 135 | 16 | 155 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010030072.1 | 1e-106 | PREDICTED: NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 4e-56 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A059ASW0 | 1e-104 | A0A059ASW0_EUCGR; Uncharacterized protein | ||||
STRING | XP_010030072.1 | 1e-105 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3674 | 28 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 5e-58 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|