PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS744841.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 189aa MW: 22126.9 Da PI: 11.1308 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 102.6 | 5.4e-32 | 41 | 118 | 50 | 128 |
NAM 50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 k+k+++ ewyfFs dkky +g+++nrat++gyWk+tgkd+++++ +++vg+kktLv+++grap+g++t+Wvmheyrl EcS744841.10 41 KLKSRDLEWYFFSVLDKKYGNGSKTNRATENGYWKTTGKDRAIYH-YSRTVGMKKTLVYHNGRAPRGQRTNWVMHEYRL 118 5566778**************************************.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 35.891 | 1 | 141 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.57E-39 | 42 | 141 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.6E-16 | 44 | 118 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MIALKFFVVV FDLVVMTWRA ISLAAPSSFA GTSAKRQDKS KLKSRDLEWY FFSVLDKKYG 60 NGSKTNRATE NGYWKTTGKD RAIYHYSRTV GMKKTLVYHN GRAPRGQRTN WVMHEYRLTD 120 EELAKAGIPQ DAFVLCRIFQ KSGSGPKTGS NMVHRSLRRN GRMMMWPCFL IRSKWWVFMM 180 NMLRQMTWI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 1e-29 | 48 | 147 | 75 | 174 | NAC domain-containing protein 19 |
3swm_B | 1e-29 | 48 | 147 | 75 | 174 | NAC domain-containing protein 19 |
3swm_C | 1e-29 | 48 | 147 | 75 | 174 | NAC domain-containing protein 19 |
3swm_D | 1e-29 | 48 | 147 | 75 | 174 | NAC domain-containing protein 19 |
3swp_A | 1e-29 | 48 | 147 | 75 | 174 | NAC domain-containing protein 19 |
3swp_B | 1e-29 | 48 | 147 | 75 | 174 | NAC domain-containing protein 19 |
3swp_C | 1e-29 | 48 | 147 | 75 | 174 | NAC domain-containing protein 19 |
3swp_D | 1e-29 | 48 | 147 | 75 | 174 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010032131.1 | 1e-74 | PREDICTED: NAC domain-containing protein 78 | ||||
Swissprot | Q84K00 | 6e-63 | NAC78_ARATH; NAC domain-containing protein 78 | ||||
TrEMBL | A0A059ADS6 | 2e-73 | A0A059ADS6_EUCGR; Uncharacterized protein | ||||
STRING | XP_010032131.1 | 4e-74 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1780 | 28 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04410.1 | 4e-65 | NAC domain containing protein 2 |