Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 171.6 | 2.3e-53 | 9 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96
l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs dkky++g+++nrat++gyWk+tgkd+e+ + +
AT5G04410.1 9 LAPGFRFHPTDEELVRYYLKRKVCNKPFKF-DAISVTDIYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRN-G 104
579**************************9.99**************95347777888*************************************9.9 PP
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128
+++vg+kktLv++kgrap+ge+t+Wvmheyrl
AT5G04410.1 105 SRVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
******************************98 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Barrier M,Bustamante CD,Yu J,Purugganan MD
Selection on rapidly evolving proteins in the Arabidopsis genome. Genetics, 2003. 163(2): p. 723-33 [PMID:12618409] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Ooka H, et al.
Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Kim SY, et al.
Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation. Nucleic Acids Res., 2007. 35(1): p. 203-13 [PMID:17158162] - Yoo SY,Kim Y,Kim SY,Lee JS,Ahn JH
Control of flowering time and cold response by a NAC-domain protein in Arabidopsis. PLoS ONE, 2007. 2(7): p. e642 [PMID:17653269] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] - Morishita T, et al.
Arabidopsis NAC transcription factor, ANAC078, regulates flavonoid biosynthesis under high-light. Plant Cell Physiol., 2009. 50(12): p. 2210-22 [PMID:19887540] - Balazadeh S, et al.
A gene regulatory network controlled by the NAC transcription factor ANAC092/AtNAC2/ORE1 during salt-promoted senescence. Plant J., 2010. 62(2): p. 250-64 [PMID:20113437] - Yabuta Y, et al.
Identification of recognition sequence of ANAC078 protein by the cyclic amplification and selection of targets technique. Plant Signal Behav, 2010. 5(6): p. 695-7 [PMID:20404498] - Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
14-3-3 proteins fine-tune plant nutrient metabolism. FEBS Lett., 2011. 585(1): p. 143-7 [PMID:21094157] - Yabuta Y, et al.
Involvement of Arabidopsis NAC transcription factor in the regulation of 20S and 26S proteasomes. Plant Sci., 2011. 181(4): p. 421-7 [PMID:21889048] - Nguyen HM, et al.
An upstream regulator of the 26S proteasome modulates organ size in Arabidopsis thaliana. Plant J., 2013. 74(1): p. 25-36 [PMID:23252408] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Liang M, et al.
Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana. Traffic, 2015. 16(10): p. 1062-74 [PMID:26201836] - Xiao D, et al.
SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] - Gladman NP,Marshall RS,Lee KH,Vierstra RD
The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis. Plant Cell, 2016. 28(6): p. 1279-96 [PMID:27194708] - Tang Y,Zhao CY,Tan ST,Xue HW
Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078. PLoS Genet., 2016. 12(8): p. e1006252 [PMID:27529511]
|