PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS656811.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 55aa MW: 6244.92 Da PI: 5.6272 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 32.4 | 2.6e-10 | 2 | 51 | 45 | 94 |
DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +l+++p+++r da++ lvyeA+ar +dPv+G g + ++ + e+l++ EcS656811.10 2 ILQQVPNDRRADAIHRLVYEANARENDPVNGRRGQLAQMIAEEERLQVPH 51 799*********************************99999999888755 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 8.55 | 1 | 55 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.6E-8 | 2 | 49 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 55 aa Download sequence Send to blast |
EILQQVPNDR RADAIHRLVY EANARENDPV NGRRGQLAQM IAEEERLQVP HQAAG |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A059AGU2 | 8e-29 | A0A059AGU2_EUCGR; Uncharacterized protein | ||||
STRING | XP_010033333.1 | 1e-29 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM35076 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16530.1 | 2e-08 | ASYMMETRIC LEAVES 2-like 9 |