PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS626816.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 173aa MW: 19203.9 Da PI: 6.5034 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 190.9 | 8.1e-59 | 9 | 161 | 220 | 374 |
GRAS 220 leserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWr 316 + ++ +vL ++sl+Pk+v+v+eqea+hn++ Fl+rf+eal+yys+lfdslea p + ++ + +++l+rei+n+v cega+r+erhe l +Wr EcS626816.10 9 RDPPIGSVLPWIRSLNPKIVTVAEQEANHNRPGFLDRFTEALYYYSTLFDSLEAACP--VQPDKALAEMYLQREICNIVGCEGAARVERHEPLDRWR 103 5556789************************************************75..45667788899*************************** PP GRAS 317 erleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 +rl++aGF+p++l+++a kqa++ll ++ +gy+vee++g+l+l+W++rpL+++SaW+ EcS626816.10 104 ARLGRAGFRPLHLGSNAFKQASMLLTLFSIEGYSVEENEGCLTLCWHSRPLIAASAWQ 161 *********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 25.718 | 1 | 141 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.8E-56 | 9 | 161 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
RLLGSDPPRD PPIGSVLPWI RSLNPKIVTV AEQEANHNRP GFLDRFTEAL YYYSTLFDSL 60 EAACPVQPDK ALAEMYLQRE ICNIVGCEGA ARVERHEPLD RWRARLGRAG FRPLHLGSNA 120 FKQASMLLTL FSIEGYSVEE NEGCLTLCWH SRPLIAASAW QAAPTVVNSP AGV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 1e-24 | 20 | 160 | 238 | 378 | Protein SCARECROW |
5b3h_A | 1e-24 | 20 | 160 | 237 | 377 | Protein SCARECROW |
5b3h_D | 1e-24 | 20 | 160 | 237 | 377 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). {ECO:0000250}. | |||||
UniProt | Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010049952.1 | 1e-121 | PREDICTED: DELLA protein GAI | ||||
Swissprot | Q6EI06 | 4e-63 | GAIP_CUCMA; DELLA protein GAIP | ||||
Swissprot | Q8S4W7 | 4e-63 | GAI1_VITVI; DELLA protein GAI1 | ||||
TrEMBL | A0A059CXT5 | 1e-120 | A0A059CXT5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010049952.1 | 1e-120 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM837 | 28 | 121 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14920.1 | 5e-63 | GRAS family protein |