 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
EcS578350.10 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
| Family |
G2-like |
| Protein Properties |
Length: 72aa MW: 7668.73 Da PI: 10.051 |
| Description |
G2-like family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| EcS578350.10 | genome | ECGD | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | G2-like | 50.6 | 4.4e-16 | 2 | 32 | 26 | 56 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRla 56
+A+Pk+il+lm+v+g+t+e+v+SHLQkYRl+
EcS578350.10 2 EAVPKKILDLMNVEGITRENVASHLQKYRLY 32
69***************************85 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
| UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
