Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | G2-like | 91.7 | 6.1e-29 | 177 | 230 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kpr++W++eLH++Fv+av+qL G +kA+Pk+il+lm+++gLt+e+v+SHLQkYRl
AT5G58080.1 177 KPRVVWSQELHQKFVSAVQQL-GLDKAVPKKILDLMSIEGLTRENVASHLQKYRL 230
79*******************.********************************8 PP
|
2 | Response_reg | 67 | 8.5e-23 | 3 | 110 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95
vl vdD+p+ ++ l+++l + +y +v+ + ++++ale+l+e+ +Dl++ D+emp+ dG++ll+ e ++lp+i+++ah++ + + + + Ga
AT5G58080.1 3 VLAVDDNPTCLRKLEELLLRCKY-HVTKTMESRKALEMLRENSnmFDLVISDVEMPDTDGFKLLEIGLE--MDLPVIMLSAHSDYDSVMKGIIHGAC 96
799********************.***************999999******************985344..57************************ PP
EEEESS--HHHHHH CS
Response_reg 96 dflsKpfdpeelvk 109
d+l+Kp+ +el +
AT5G58080.1 97 DYLVKPVGLKELQN 110
********999975 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Hwang I,Sheen J
Two-component circuitry in Arabidopsis cytokinin signal transduction. Nature, 2001. 413(6854): p. 383-9 [PMID:11574878] - Hwang I,Chen HC,Sheen J
Two-component signal transduction pathways in Arabidopsis. Plant Physiol., 2002. 129(2): p. 500-15 [PMID:12068096] - Che P,Gingerich DJ,Lall S,Howell SH
Global and hormone-induced gene expression changes during shoot development in Arabidopsis. Plant Cell, 2002. 14(11): p. 2771-85 [PMID:12417700] - Imamura A,Kiba T,Tajima Y,Yamashino T,Mizuno T
In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana. Plant Cell Physiol., 2003. 44(2): p. 122-31 [PMID:12610214] - Heyl A,Schm
Cytokinin signal perception and transduction. Curr. Opin. Plant Biol., 2003. 6(5): p. 480-8 [PMID:12972049] - Hoth S, et al.
Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana. FEBS Lett., 2003. 554(3): p. 373-80 [PMID:14623097] - Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
Type-B response regulators display overlapping expression patterns in Arabidopsis. Plant Physiol., 2004. 135(2): p. 927-37 [PMID:15173562] - Lall S,Nettleton D,DeCook R,Che P,Howell SH
Quantitative trait loci associated with adventitious shoot formation in tissue culture and the program of shoot development in Arabidopsis. Genetics, 2004. 167(4): p. 1883-92 [PMID:15342526] - Brenner WG,Romanov GA,K
Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades. Plant J., 2005. 44(2): p. 314-33 [PMID:16212609] - Mason MG, et al.
Multiple type-B response regulators mediate cytokinin signal transduction in Arabidopsis. Plant Cell, 2005. 17(11): p. 3007-18 [PMID:16227453] - Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
A transcriptome-based characterization of habituation in plant tissue culture. Plant Physiol., 2006. 140(4): p. 1255-78 [PMID:16489130] - Ishida K,Yamashino T,Yokoyama A,Mizuno T
Three type-B response regulators, ARR1, ARR10 and ARR12, play essential but redundant roles in cytokinin signal transduction throughout the life cycle of Arabidopsis thaliana. Plant Cell Physiol., 2008. 49(1): p. 47-57 [PMID:18037673] - Gifford ML,Dean A,Gutierrez RA,Coruzzi GM,Birnbaum KD
Cell-specific nitrogen responses mediate developmental plasticity. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(2): p. 803-8 [PMID:18180456] - Day RC,Herridge RP,Ambrose BA,Macknight RC
Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation. Plant Physiol., 2008. 148(4): p. 1964-84 [PMID:18923020] - Liang Y,Wang X,Hong S,Li Y,Zuo J
Deletion of the initial 45 residues of ARR18 induces cytokinin response in Arabidopsis. J Genet Genomics, 2012. 39(1): p. 37-46 [PMID:22293116] - Veerabagu M, et al.
The Arabidopsis B-type response regulator 18 homomerizes and positively regulates cytokinin responses. Plant J., 2012. 72(5): p. 721-31 [PMID:22775331] - Veerabagu M, et al.
The interaction of the Arabidopsis response regulator ARR18 with bZIP63 mediates the regulation of PROLINE DEHYDROGENASE expression. Mol Plant, 2014. 7(10): p. 1560-77 [PMID:24948556]
|