PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC071705.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 219aa MW: 24797.9 Da PI: 10.9852 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 103.4 | 1.4e-32 | 104 | 157 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ EcC071705.10 104 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 157 9****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 8.06E-16 | 101 | 158 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.8E-29 | 102 | 157 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.6E-24 | 104 | 157 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.7E-7 | 105 | 156 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010158 | Biological Process | abaxial cell fate specification | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
WSPSISHSSS CSSKAFHSPA HYLGRSLNPF SILNSGTPDP SSSGYQIPAT GRFGGLSAYQ 60 LHQYHHHHHH HSQYAVIGSS EASHGMMRSR FVSKLPVKRS MRAPRMRWTS TLHARFVHAV 120 ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTVKT TDKPAASSGN AQCFSFTFFP 180 PKQRSNTIER ERERERERER ERERGENRKS SASLNLRGL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 3e-17 | 105 | 159 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 3e-17 | 105 | 159 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 3e-17 | 105 | 159 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 3e-17 | 105 | 159 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 3e-17 | 105 | 159 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 3e-17 | 105 | 159 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 3e-17 | 105 | 159 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 3e-17 | 105 | 159 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 193 | 203 | RERERERERER |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010062308.1 | 2e-90 | PREDICTED: transcription repressor KAN1 isoform X2 | ||||
Swissprot | Q93WJ9 | 2e-48 | KAN1_ARATH; Transcription repressor KAN1 | ||||
TrEMBL | A0A059BUZ6 | 4e-89 | A0A059BUZ6_EUCGR; Uncharacterized protein | ||||
STRING | XP_010062307.1 | 9e-90 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6606 | 26 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G16560.1 | 1e-49 | G2-like family protein |