PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC057266.10
Organism
Eucalyptus camaldulensis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 46aa    MW: 5087.87 Da    PI: 8.2104
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC057266.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.93.3e-19746140
        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGas 40
                  +CaaCk +rrkC+++Cv+apyfpa+qp+kfa+vh++FGas
  EcC057266.10  7 PCAACKCQRRKCTPECVFAPYFPADQPQKFAYVHEVFGAS 46
                  7*************************************86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.313646IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-17746IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 46 aa     Download sequence    Send to blast
MSSLSSPCAA CKCQRRKCTP ECVFAPYFPA DQPQKFAYVH EVFGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-16546950LOB family transfactor Ramosa2.1
5ly0_B4e-16546950LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010026421.13e-26PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FKZ31e-19LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A484N5R73e-19A0A484N5R7_9ASTE; Uncharacterized protein (Fragment)
STRINGXP_010026421.11e-25(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-22ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]