PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC052334.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 94aa MW: 10773.2 Da PI: 5.2465

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC052334.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	33.4	1.1e-10	44	83	3	44
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++++E+el+++ + + G + W++Ia +++ gRt++++ +w EcC052334.10 44 EFSEDEEELIARMFSLVGER-WSLIAGRIP-GRTAEEIEKFW 83 69****************.*****.******999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.205	37	94	IPR017930	Myb domain
SMART	SM00717	9.5E-8	41	89	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.09E-8	42	85	IPR009057	Homeodomain-like
Pfam	PF00249	9.7E-10	44	83	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-12	44	85	IPR009057	Homeodomain-like
CDD	cd00167	5.90E-7	44	83	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006979	Biological Process	response to oxidative stress
GO:0055114	Biological Process	oxidation-reduction process
GO:0003677	Molecular Function	DNA binding
GO:0004601	Molecular Function	peroxidase activity
GO:0020037	Molecular Function	heme binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
WEEETTALMK AIGVQKLASY PYCSNDEPKR CLLLGAKREE SKAEFSEDEE ELIARMFSLV 60 GERWSLIAGR IPGRTAEEIE KFWASKHSAS NHQR

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269\|PubMed:15063185, ECO:0000269\|PubMed:15584952}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010052842.1	2e-35	PREDICTED: transcription factor CPC
Swissprot	Q9LNI5	4e-17	ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBL	A0A059CEU4	4e-34	A0A059CEU4_EUCGR; Uncharacterized protein
STRING	XP_010052842.1	6e-35	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01380.1	5e-17	MYB_related family protein

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tominaga-Wada R,Kurata T,Wada T Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis. J. Plant Physiol., 2017. 214: p. 48-52 [PMID:28437677] Tominaga-Wada R,Kurata T,Wada T Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis. Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767 [PMID:28644769] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Tominaga-Wada R,Wada T Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis. Dev. Biol., 2018. 435(1): p. 1-5 [PMID:29337129]