PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC051022.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 134aa MW: 15519.8 Da PI: 10.5472 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.6 | 3.4e-19 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WTt+Ed++l d++k +G g W+ I+++ g++R++k+c++rw++yl EcC051022.10 15 RGAWTTDEDKRLTDYIKVHGEGKWRNIPKRAGLKRCGKSCRLRWLNYL 62 89*********************************************7 PP | |||||||
2 | Myb_DNA-binding | 52.1 | 1.5e-16 | 68 | 112 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ T +E++l+++++++lG++ W++Ia +++ gRt++++k++w++ EcC051022.10 68 RGNITSDEEDLIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 112 7999******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.588 | 10 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.41E-30 | 13 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.3E-14 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.7E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-24 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.69E-10 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 19.509 | 67 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-14 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-14 | 68 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-24 | 70 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.47E-10 | 72 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MGRSPCCSKD EGLNRGAWTT DEDKRLTDYI KVHGEGKWRN IPKRAGLKRC GKSCRLRWLN 60 YLRPDIKRGN ITSDEEDLII RLHRLLGNRW SLIAGRLPGR TDNEIKNYWN STLAKREQGE 120 KKPSLSATEK INPM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-29 | 13 | 116 | 25 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010047390.1 | 9e-93 | PREDICTED: anthocyanin regulatory C1 protein | ||||
Swissprot | P10290 | 2e-62 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A059CM24 | 2e-91 | A0A059CM24_EUCGR; Uncharacterized protein | ||||
STRING | XP_010047390.1 | 4e-92 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16720.1 | 1e-60 | myb domain protein 7 |