PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC049096.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 160aa MW: 17282.2 Da PI: 8.3594 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 140.8 | 4.4e-44 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 +CaaCk lrrkC+++Cv+apyfpa+qp+kfa+vhk+FGasnv+kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+ l++ela++ EcC049096.10 7 PCAACKCLRRKCTQECVFAPYFPADQPQKFAYVHKVFGASNVTKLLNELNVSQREDAVNSLAYEAETRLRDPVYGCVGLISILQHKLDLLQKELASA 103 7***********************************************************************************************9 PP DUF260 98 kee 100 k+e EcC049096.10 104 KKE 106 987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.681 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.7E-43 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0005507 | Molecular Function | copper ion binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0005524 | Molecular Function | ATP binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0016491 | Molecular Function | oxidoreductase activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MSSSNSPCAA CKCLRRKCTQ ECVFAPYFPA DQPQKFAYVH KVFGASNVTK LLNELNVSQR 60 EDAVNSLAYE AETRLRDPVY GCVGLISILQ HKLDLLQKEL ASAKKELATY VGPHAMIPTM 120 MQPSGAPPYM GNPSMSAVVP YNMMPMMGIP TAAAAGGPPL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-50 | 3 | 121 | 7 | 126 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-50 | 3 | 121 | 7 | 126 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010070501.1 | 1e-116 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_010070502.1 | 1e-116 | PREDICTED: LOB domain-containing protein 36-like | ||||
Swissprot | Q9FKZ3 | 3e-70 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A061DMY0 | 1e-79 | A0A061DMY0_THECC; ASYMMETRIC LEAVES 2-like 1 | ||||
TrEMBL | A0A0B0PS92 | 9e-80 | A0A0B0PS92_GOSAR; LOB domain-containing 36-like protein | ||||
TrEMBL | A0A2P5Y5K0 | 7e-80 | A0A2P5Y5K0_GOSBA; Uncharacterized protein | ||||
STRING | XP_010070501.1 | 1e-116 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 1e-68 | ASYMMETRIC LEAVES 2-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|