PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC048748.30 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 116aa MW: 13666.9 Da PI: 9.268 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 74.1 | 2.7e-23 | 8 | 113 | 268 | 373 |
GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364 f +++a l +s+ r + r + grei+nv+ ceg er+er +t+++W+ r ++aGFk++pl+++ k + +++ + + + ++e+ +++++gW++ EcC048748.30 8 FSMFDAILNGDSRVRLVFKRDFHGREIMNVIVCEGLERVERPKTYKQWQVRHMSAGFKALPLDQELLKLFRGKMKESYHKDFALDEDGNWMLQGWRG 104 44555666669*******************************************************************888**************** PP GRAS 365 rpLvsvSaW 373 r ++ S+W EcC048748.30 105 RIIYGSSCW 113 ********* PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 14.918 | 1 | 94 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 9.3E-21 | 8 | 113 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0015074 | Biological Process | DNA integration | ||||
GO:0003676 | Molecular Function | nucleic acid binding | ||||
GO:0004523 | Molecular Function | RNA-DNA hybrid ribonuclease activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
SCSIFGFFSM FDAILNGDSR VRLVFKRDFH GREIMNVIVC EGLERVERPK TYKQWQVRHM 60 SAGFKALPLD QELLKLFRGK MKESYHKDFA LDEDGNWMLQ GWRGRIIYGS SCWVPI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010043539.1 | 3e-60 | PREDICTED: scarecrow-like protein 34 | ||||
Swissprot | Q3EDH0 | 5e-43 | SCL31_ARATH; Scarecrow-like protein 31 | ||||
TrEMBL | A0A059D484 | 6e-59 | A0A059D484_EUCGR; Uncharacterized protein | ||||
STRING | XP_010043539.1 | 1e-59 | (Eucalyptus grandis) | ||||
STRING | XP_010046393.1 | 2e-60 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07520.1 | 2e-45 | GRAS family protein |