PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC039113.30 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 133aa MW: 15647.2 Da PI: 10.6634 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.4 | 1.8e-14 | 19 | 66 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +lv ++ ++G +W+ a+ g+ Rt+k+c++rw +yl EcC039113.30 19 KGAWSAEEDRKLVAYIMRYGVWNWTHMAEPAGLARTGKSCRLRWMNYL 66 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.7 | 1.1e-17 | 74 | 115 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 + T+eE+e++++++k lG++ W+tIa++++ gRt++++k++w++ EcC039113.30 74 NVTKEEEEIIIKLHKVLGNR-WATIASRLP-GRTDNEIKNYWNT 115 669*****************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.193 | 14 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.19E-30 | 17 | 113 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.7E-11 | 18 | 68 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-13 | 19 | 66 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-23 | 20 | 73 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.91E-8 | 21 | 66 | No hit | No description |
PROSITE profile | PS51294 | 24.196 | 67 | 121 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-16 | 71 | 119 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-25 | 74 | 121 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.6E-15 | 76 | 115 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.25E-11 | 76 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MARYPRVDKI SSSSKTVKKG AWSAEEDRKL VAYIMRYGVW NWTHMAEPAG LARTGKSCRL 60 RWMNYLRPNI KHGNVTKEEE EIIIKLHKVL GNRWATIASR LPGRTDNEIK NYWNTRLKKR 120 FIQEKLEMPI ACD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-31 | 19 | 121 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010054183.1 | 1e-89 | PREDICTED: transcription factor WER-like | ||||
Swissprot | Q9M0J5 | 8e-47 | MYB41_ARATH; Transcription factor MYB41 | ||||
TrEMBL | A0A059AM79 | 9e-78 | A0A059AM79_EUCGR; Uncharacterized protein | ||||
STRING | XP_010054183.1 | 4e-89 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 2e-43 | myb domain protein 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|