PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC038892.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 87aa MW: 9878.42 Da PI: 10.1262

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC038892.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.5	5.3e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrWT+eEd +l++++k G g+W++ ++ g+ R++k+c++rw +yl EcC038892.10 14 RGRWTAEEDAILLNYIKANGEGHWRSLPKNAGLLRCGKSCRLRWVNYL 61 8*****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.4E-22	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.419	9	65	IPR017930	Myb domain
SMART	SM00717	2.3E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.0E-14	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.75E-20	15	87	IPR009057	Homeodomain-like
CDD	cd00167	1.86E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.0E-6	65	87	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MGRAPCCEKV GLKRGRWTAE EDAILLNYIK ANGEGHWRSL PKNAGLLRCG KSCRLRWVNY 60 LRTDLRRGNI STEEENVIIK LHASLGN

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010069870.1	5e-56	PREDICTED: myb-related protein Myb4
Swissprot	P27898	5e-47	MYBP_MAIZE; Myb-related protein P
TrEMBL	A0A059AX98	1e-54	A0A059AX98_EUCGR; Uncharacterized protein
STRING	XP_010069870.1	2e-55	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47460.1	3e-49	myb domain protein 12

Publications ? help Back to Top
Robbins ML,Sekhon RS,Meeley R,Chopra S A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] Sidorenko L,Chandler V RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] Robbins ML,Wang P,Sekhon RS,Chopra S Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] Rhee Y,Sekhon RS,Chopra S,Kaeppler S Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] Morohashi K, et al. A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204]