PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC028521.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 62aa MW: 7314.57 Da PI: 10.765 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.1 | 5e-18 | 7 | 41 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C +Cg+ +TplWR+gp ++ LCnaCG ++r+kg+ EcC028521.10 7 CYHCGVRETPLWRHGPTEKPVLCNACGSRWRLKGS 41 ****************99999************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 8.2E-10 | 1 | 55 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.38E-13 | 6 | 45 | No hit | No description |
CDD | cd00202 | 2.30E-14 | 6 | 58 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 5.0E-15 | 7 | 41 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE profile | PS50114 | 12.492 | 7 | 57 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 6.0E-16 | 7 | 41 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MVKQGPCYHC GVRETPLWRH GPTEKPVLCN ACGSRWRLKG SLDDYVPKRY RAVVRKRRFQ 60 NI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018718057.1 | 1e-40 | PREDICTED: GATA transcription factor 27-like | ||||
Swissprot | Q5PP38 | 3e-24 | GAT27_ARATH; GATA transcription factor 27 | ||||
TrEMBL | A0A078HUW7 | 3e-23 | A0A078HUW7_BRANA; BnaC02g33240D protein | ||||
TrEMBL | A0A2I0JBG5 | 2e-23 | A0A2I0JBG5_PUNGR; Uncharacterized protein | ||||
STRING | XP_010030935.1 | 2e-39 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM18902 | 6 | 8 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47140.1 | 1e-26 | GATA transcription factor 27 |