PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC021761.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 146aa MW: 17045.3 Da PI: 6.3416 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 108.2 | 9.7e-34 | 14 | 135 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkklel.eev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrF Ptdeelv ++L++k ++ +++ + +++++ ++++PwdL+ k+ ++ +++++Fs+ +nr+t++gyWk +++v+++ EcC021761.20 14 LPPGFRFLPTDEELVLHFLRPKKQQASVSSlYAHlVPDLKSHHHDPWDLHGKALSNGTHYFYFSRM--------MNNRITENGYWKDLDMEESVFAE 102 79********************99999554133359*************95554544444444443........358******************** PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ge +g+kk+L+f+ g+ap+g++t+W+m+ey+l EcC021761.20 103 AGEIIGMKKSLTFHIGEAPTGQETNWMMQEYHL 135 ********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.35E-37 | 11 | 138 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 35.891 | 14 | 146 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.5E-22 | 15 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
IKEKEEDDGK MLKLPPGFRF LPTDEELVLH FLRPKKQQAS VSSLYAHLVP DLKSHHHDPW 60 DLHGKALSNG THYFYFSRMM NNRITENGYW KDLDMEESVF AEAGEIIGMK KSLTFHIGEA 120 PTGQETNWMM QEYHLMSFHQ LVNPTQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 5e-27 | 4 | 136 | 10 | 146 | NAC domain-containing protein 19 |
3swm_B | 5e-27 | 4 | 136 | 10 | 146 | NAC domain-containing protein 19 |
3swm_C | 5e-27 | 4 | 136 | 10 | 146 | NAC domain-containing protein 19 |
3swm_D | 5e-27 | 4 | 136 | 10 | 146 | NAC domain-containing protein 19 |
3swp_A | 5e-27 | 4 | 136 | 10 | 146 | NAC domain-containing protein 19 |
3swp_B | 5e-27 | 4 | 136 | 10 | 146 | NAC domain-containing protein 19 |
3swp_C | 5e-27 | 4 | 136 | 10 | 146 | NAC domain-containing protein 19 |
3swp_D | 5e-27 | 4 | 136 | 10 | 146 | NAC domain-containing protein 19 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010027642.1 | 1e-103 | PREDICTED: NAC domain-containing protein 104 isoform X3 | ||||
TrEMBL | A0A059AKC3 | 1e-101 | A0A059AKC3_EUCGR; Uncharacterized protein | ||||
STRING | XP_010027642.1 | 1e-102 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 7e-39 | xylem NAC domain 1 |