PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC016308.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 76aa MW: 8598.38 Da PI: 6.1009 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.1 | 6.2e-11 | 26 | 65 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++++E+el+++ + + G + W++Ia +++ gRt++++ +w EcC016308.10 26 EFSEDEEELIARMFSLVGER-WSLIAGRIP-GRTAEEIEKFW 65 69******************.*********.********999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.205 | 19 | 76 | IPR017930 | Myb domain |
SMART | SM00717 | 9.5E-8 | 23 | 71 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.08E-9 | 24 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.79E-7 | 26 | 65 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-12 | 26 | 67 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.6E-10 | 26 | 65 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0080147 | Biological Process | root hair cell development | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MGGRDHSSHE SNRGAEGAKR EESKAEFSED EEELIARMFS LVGERWSLIA GRIPGRTAEE 60 IEKFWASKHS ASNHQR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010052842.1 | 1e-47 | PREDICTED: transcription factor CPC | ||||
Swissprot | Q9LNI5 | 8e-18 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | A0A059CEU4 | 3e-46 | A0A059CEU4_EUCGR; Uncharacterized protein | ||||
STRING | XP_010052842.1 | 5e-47 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 1e-17 | MYB_related family protein |