PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC012760.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 128aa MW: 13805.3 Da PI: 11.4044 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 34.6 | 2.7e-11 | 32 | 63 | 4 | 35 |
GATA 4 CgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 + kTp+WR gp g +tL naCG+ yr+ ++ EcC012760.10 32 YTSEKTPQWRTGPLGRRTLYNACGVQYRSGRQ 63 55678***********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 1.5E-5 | 23 | 73 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.71E-7 | 24 | 72 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 3.4E-8 | 27 | 61 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 4.1E-9 | 29 | 63 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
RLGTSPAALN EGPGPTEVEG DRGGAKRRCT HYTSEKTPQW RTGPLGRRTL YNACGVQYRS 60 GRQVPKYRLV VSPTFLLTQQ SNSHWKAALS DSRPRNRHSR TAPSRIHSPA SEGAGPAEAE 120 GGGGGVKR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020880430.1 | 7e-26 | GATA transcription factor 4 | ||||
Swissprot | O49741 | 2e-25 | GATA2_ARATH; GATA transcription factor 2 | ||||
TrEMBL | A0A0A9GYF6 | 1e-25 | A0A0A9GYF6_ARUDO; GATA transcription factor | ||||
STRING | fgenesh2_kg.5__2520__AT3G60530.1 | 3e-25 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3203 | 26 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45050.1 | 5e-28 | GATA transcription factor 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|