PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC006265.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 172aa MW: 19827.8 Da PI: 9.9769 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63.2 | 5.2e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lvd+++++G g+W+t ++ g+ R++k+c++rw +yl EcC006265.20 14 KGPWTPEEDQKLVDYIHKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.2 | 3.3e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr++ eE+e +++++ lG++ W++Ia++++ gRt++++k++w+++ EcC006265.20 67 RGRFSFEEEETIIQLHGILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.0E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.495 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.47E-32 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.0E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.9E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.43E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.7E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.076 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.6E-15 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.27E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0046854 | Biological Process | phosphatidylinositol phosphorylation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MGRAPCCEKS GLKKGPWTPE EDQKLVDYIH KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY 60 LRPDIKRGRF SFEEEETIIQ LHGILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG 120 IDPVTHAPRL DLLDLSSFVN PCLFNNSSWA QVNLSRLLGI DPPIDPEQLR LA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-30 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010057758.1 | 1e-127 | PREDICTED: transcription factor MYB3 | ||||
Swissprot | Q9LDR8 | 1e-100 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A059C9A9 | 1e-126 | A0A059C9A9_EUCGR; Uncharacterized protein | ||||
STRING | XP_010057758.1 | 1e-127 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 1e-102 | MYB-like 102 |
Publications ? help Back to Top | |||
---|---|---|---|
|