PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC000338.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 80aa MW: 9091.29 Da PI: 9.3137 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 124.1 | 2e-38 | 10 | 62 | 118 | 170 |
YABBY 118 PPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 PekrqrvPsayn+fikeeiqrikasnPdishreafs+aaknWahfP+ihfgl EcC000338.10 10 APEKRQRVPSAYNQFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 62 6**************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47095 | 2.36E-8 | 10 | 56 | IPR009071 | High mobility group box domain |
Pfam | PF04690 | 1.4E-36 | 10 | 62 | IPR006780 | YABBY protein |
Gene3D | G3DSA:1.10.30.10 | 3.2E-5 | 11 | 54 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MSCSFLGFAA PEKRQRVPSA YNQFIKEEIQ RIKASNPDIS HREAFSTAAK NWAHFPHIHF 60 GLMLDNNNQA KMDNVSSSLL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010048072.1 | 1e-41 | PREDICTED: axial regulator YABBY 5 | ||||
Swissprot | Q8GW46 | 1e-37 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A059CQE3 | 2e-41 | A0A059CQE3_EUCGR; Uncharacterized protein | ||||
STRING | XP_010048072.1 | 4e-41 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5538 | 26 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 5e-40 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|