PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dusal.0509s00011.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Dunaliellaceae; Dunaliella
Family G2-like
Protein Properties Length: 404aa    MW: 43611.4 Da    PI: 7.3859
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dusal.0509s00011.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.79.5e-27333385255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           +rl+Wtp+LH+rF eave+L G+ekA+Pk+i++ m+++gLt+e+v+SHLQk+Rl
  Dusal.0509s00011.2.p 333 ARLVWTPQLHKRFEEAVEKL-GHEKAVPKNIMQEMNIEGLTRENVASHLQKWRL 385
                           79******************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.45E-18329389IPR009057Homeodomain-like
PROSITE profilePS512949.406329388IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-25331387IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-22333385IPR006447Myb domain, plants
PfamPF002492.7E-9335384IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MEDTLVPLDA TLFNASLGKA FGLPGFGTTT TARGGPPPPP PASASWAGSL QHQQQGPFGA  60
GAGSKPVAIW GGAAKEELLR RSTQQQQQQQ QQHQQHQQQL PSFPLLQPEL PLPAVQQSAV  120
SGMAGLSVGS SGQHQQQLLQ QQRSSFDSGM AAALQQQRSS LEAAQQRPSF ESVVAAAQHR  180
PSFESVVAAA QQRSSFEEGV AAAMQQQQQQ QQQQRSSFEQ QQRASFEGGV AASNQLFQAQ  240
QFMAAQASFP HQHLNSIQQS VPLQSFNPFG PLQMPGGLDF TQQGLLAGCP PAYCKPPPYQ  300
QQPVGHASST GTTGTDMTEE DDEQGSARTV KRARLVWTPQ LHKRFEEAVE KLGHEKAVPK  360
NIMQEMNIEG LTRENVASHL QKWRLLEKKN GRGSTEGRTD ASC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A6e-21332388157Transcription factor LUX
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.11e-24G2-like family protein