PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dusal.0423s00003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Dunaliellaceae; Dunaliella
Family G2-like
Protein Properties Length: 673aa    MW: 67874 Da    PI: 6.3011
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dusal.0423s00003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.7e-32191245155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k rlrWtpeLH rFv+av+qLGG+++AtPk il+l++ +gLt++h+kSHLQkYRl
  Dusal.0423s00003.1.p 191 KSRLRWTPELHGRFVQAVNQLGGPDRATPKGILKLVNSEGLTIYHIKSHLQKYRL 245
                           68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.032187248IPR017930Myb domain
SuperFamilySSF466894.66E-17191248IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23191245IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.4E-29191247IPR009057Homeodomain-like
PfamPF002496.1E-9193244IPR001005SANT/Myb domain
PfamPF143792.6E-14426468IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MSSAPSDDLT DFLEYWPEPD MNSLLNAFAA PPPAPAAADA AAAAAASAQD NFQHQQATFL  60
PPPPPHHIPA FPPVDIHAST TSDAHHHSQG GSSGVAAAAA AVAVAGNTAM AGNFFPHALT  120
DPAASAAQGA PSIVSMEGSN MHSGSGPAFH GAAPLPALPG LPPPASMSIP GLAHQPFFSS  180
IPQVSGDQGI KSRLRWTPEL HGRFVQAVNQ LGGPDRATPK GILKLVNSEG LTIYHIKSHL  240
QKYRLNIKLP AESGGSGSRF LMGMGGGSGS MGGGSTGYMG GSGAGNSGRA ASAAPAESLG  300
DSQEQGAAAG GTSAASTEVG SGFQGAGAGA PPPRMGPSLF SPHAFQHQPL TAQQQQQLLG  360
GSSWGAVVGG AGEQAGGTGG MLVMGQQGVV GTSSGGAGGV AGGAQPSSSI GAGGSAASGT  420
QSSMSLEAAL LFQMEMQKKL HEQLESQRQL QLSLEAHGRY LATLIEQEAR GGGSSQILAQ  480
HLVGPMGSIA RAGSVSTHLA LGGPTDSSRG PQVLPTTSCS QIVPTPSAAE TMGATADEGL  540
QEGAQYQQQQ PQQQQQQPQL ESDPKEHEEQ EGPCAPAHTA TPQQLPACTS HSQPLSGGVH  600
VGGGSGEGGV GVRSSERSKR HRRGEDDAGM QQFQLYAQEG VEHLLQTKGV CEGHNLCLHQ  660
EEVPPVGKKH RS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-22191244154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-22191244154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-22191244154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-22191244154Protein PHOSPHATE STARVATION RESPONSE 1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.16e-24G2-like family protein