PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Do029794.1

Organism

Dichanthelium oligosanthes

Taxonomic ID

888268

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

bZIP

Protein Properties

Length: 132aa MW: 14960.3 Da PI: 10.3576

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do029794.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	20.8	8.7e-07	58	107	5	54
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 kr +r N rs +RK +++ eLe+kv+++e+e ++L +l l++ Do029794.1 58 KRIKRILANQQLVARSKERKIKYTSELERKVQTMETEATTLSAQLTLLQN 107 77788888888889****************************99998876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.7E-5	54	125	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	8.508	56	107	IPR004827	Basic-leucine zipper domain
Pfam	PF07716	1.2E-5	56	106	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	9.14E-8	58	107	No hit	No description
Gene3D	G3DSA:1.20.5.170	4.7E-7	58	107	No hit	No description
CDD	cd14703	9.26E-16	59	106	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 132 aa Download sequence Send to blast
MASRCRGRRR GRAQEERLHG RGDLAIRGRV CAAGCAPGLR QEGLAAEKLA EHALLDPKRI 60 KRILANQQLV ARSKERKIKY TSELERKVQT METEATTLSA QLTLLQNPGY PQKRKYHLVV 120 DVCETYDCFS QP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269\|PubMed:11432846, ECO:0000269\|PubMed:12124400, ECO:0000269\|PubMed:15108305, ECO:0000269\|PubMed:15824315, ECO:0000269\|PubMed:17947581, ECO:0000269\|PubMed:19820165, ECO:0000269\|PubMed:20547563}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do029794.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269\|PubMed:15108305}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025827841.1	1e-27	transcription factor VIP1-like isoform X1
Refseq	XP_025827842.1	4e-28	transcription factor VIP1-like isoform X2
Swissprot	Q9MA75	8e-25	VIP1_ARATH; Transcription factor VIP1
TrEMBL	A0A1E5ULD4	4e-91	A0A1E5ULD4_9POAL; Uncharacterized protein
STRING	Pavir.Ha01827.1.p	6e-27	(Panicum virgatum)
STRING	Pavir.Hb01916.1.p	1e-27	(Panicum virgatum)
STRING	Si026605m	6e-27	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP17792	7	9

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G43700.1	4e-13	VIRE2-interacting protein 1

Publications ? help Back to Top
Wang Y, et al. The putative Agrobacterium transcriptional activator-like virulence protein VirD5 may target T-complex to prevent the degradation of coat proteins in the plant cell nucleus. New Phytol., 2014. 203(4): p. 1266-81 [PMID:24865527] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Chen J, et al. ZmbZIP91 regulates expression of starch synthesis-related genes by binding to ACTCAT elements in their promoters. J. Exp. Bot., 2016. 67(5): p. 1327-38 [PMID:26689855] Tsugama D,Liu S,Takano T VIP1 is very important/interesting protein 1 regulating touch responses of Arabidopsis. Plant Signal Behav, 2016. 11(6): p. e1187358 [PMID:27171129] Tsugama D,Liu S,Takano T The bZIP Protein VIP1 Is Involved in Touch Responses in Arabidopsis Roots. Plant Physiol., 2016. 171(2): p. 1355-65 [PMID:27208231] Takeo K,Ito T Subcellular localization of VIP1 is regulated by phosphorylation and 14-3-3 proteins. FEBS Lett., 2017. 591(13): p. 1972-1981 [PMID:28542772] Wang L,Lacroix B,Guo J,Citovsky V The Agrobacterium VirE2 effector interacts with multiple members of the Arabidopsis VIP1 protein family. Mol. Plant Pathol., 2018. 19(5): p. 1172-1183 [PMID:28802023]