PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do022651.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 216aa MW: 22793.9 Da PI: 10.5428 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 39.7 | 1.2e-12 | 62 | 106 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++G+g+W++I+r + Rt+ q+ s+ qky Do022651.1 62 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 106 7*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.873 | 55 | 111 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.09E-17 | 57 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-10 | 59 | 109 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 2.4E-17 | 59 | 109 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 3.8E-11 | 60 | 105 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.4E-11 | 62 | 106 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.01E-10 | 62 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MITLATTTAA WTREEDKAAA GGASAPKDGG GGGGHRREER KSSVDVGKSC SKAEQERRKG 60 IPWTEEEHRL FLLGLDKFGK GDWRSISRNF VISRTPTQVA SHAQKYFIRL NSMNRDRRRS 120 SIHDITSVTA GEVAAAGAPI TGGPAAAGAM PMGPAGMKHH HPGPPMGMYG HAPMGHPVAG 180 HMVAPAAVGT PVMFPPGHSP YVVPVGYPAP PAKMHQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:22773748}. | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q8LH59}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do022651.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT055333 | 0.0 | BT055333.2 Zea mays full-length cDNA clone ZM_BFb0024K03 mRNA, complete cds. | |||
GenBank | KJ727537 | 0.0 | KJ727537.1 Zea mays clone pUT5397 MYB-related transcription factor (MYBR76) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025819847.1 | 1e-135 | transcription factor MYBS1-like | ||||
Swissprot | B8A9B2 | 1e-90 | MYBS1_ORYSI; Transcription factor MYBS1 | ||||
Swissprot | Q8LH59 | 1e-90 | MYBS1_ORYSJ; Transcription factor MYBS1 | ||||
TrEMBL | A0A2S3HVA1 | 1e-134 | A0A2S3HVA1_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6R3I3 | 1e-134 | A0A3L6R3I3_PANMI; Uncharacterized protein | ||||
STRING | Pavir.Eb01413.1.p | 1e-134 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP9466 | 30 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G49010.1 | 5e-42 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|