PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do017935.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 182aa MW: 19859.4 Da PI: 9.2866 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.9 | 1.9e-32 | 103 | 161 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+ Do017935.1 103 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHS 161 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.8E-34 | 88 | 161 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.85E-29 | 95 | 161 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.207 | 98 | 160 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.7E-38 | 103 | 162 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.0E-25 | 104 | 160 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MLSSAADHHG SLYPLLLPGI PFCNSGAGEK PTGFVVLDAG EAAGTSAAKA GGEIASTTTA 60 TLHGSSSWWK GPVVAGEKGR MKARRKMREP RFCFQTRSDV DLLDDGYKWR KYGQKVVKNS 120 LHPRSYYRCT HSNCRVKKRV ERLSEDCRMV ITTYEGRHTH SPCSDDADAA GDRTGSCAFT 180 SL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-26 | 94 | 160 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-26 | 94 | 160 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 78 | 86 | GRMKARRKM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do017935.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT067982 | 1e-123 | BT067982.1 Zea mays full-length cDNA clone ZM_BFb0009G22 mRNA, complete cds. | |||
GenBank | BT068156 | 1e-123 | BT068156.2 Zea mays full-length cDNA clone ZM_BFb0072A01 mRNA, complete cds. | |||
GenBank | EU665432 | 1e-123 | EU665432.1 Triticum aestivum WRKY3 transcription factor mRNA, complete cds. | |||
GenBank | EU972805 | 1e-123 | EU972805.1 Zea mays clone 388369 WRKY36 - superfamily of TFs having WRKY and zinc finger domains mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025825009.1 | 1e-114 | probable WRKY transcription factor 12 | ||||
Swissprot | Q93WY4 | 8e-58 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
TrEMBL | A0A1E5V8D7 | 1e-133 | A0A1E5V8D7_9POAL; Putative WRKY transcription factor 12 | ||||
STRING | Si030985m | 1e-108 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1138 | 38 | 130 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G44745.1 | 9e-59 | WRKY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|