PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do014819.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 137aa MW: 15119.3 Da PI: 4.8616 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 58.8 | 8.8e-19 | 6 | 63 | 2 | 54 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRak 54 ++R+++t+eql +Lee++ + r+p+a+e+++++++l +++ ++V++WFqN++ Do014819.1 6 STRWCPTPEQLMILEEMYXSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKLS 63 58*****************99**********************************975 PP | |||||||
2 | Wus_type_Homeobox | 108.7 | 3.3e-35 | 5 | 64 | 2 | 61 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRe 61 ++tRW+PtpeQ++iLee+y sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+k + Do014819.1 5 PSTRWCPTPEQLMILEEMYXSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKLSN 64 689*****************************************************9655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 8.665 | 2 | 67 | IPR001356 | Homeobox domain |
SMART | SM00389 | 0.0078 | 4 | 71 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.45E-4 | 5 | 60 | No hit | No description |
Pfam | PF00046 | 1.7E-16 | 6 | 63 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 3.42E-10 | 7 | 64 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-5 | 8 | 61 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MPQTPSTRWC PTPEQLMILE EMYXSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH 60 KLSNQQLEEW DAAETMEHCN ANCGAASGSS DEGGAALQLP PCCRRPLXTL DLFPTKSTGL 120 KDECSSSKSS SCSTSTN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in leaf formation. {ECO:0000269|PubMed:15169755}. | |||||
UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in leaf formation. {ECO:0000269|PubMed:15169755}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do014819.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ536578 | 2e-79 | AJ536578.1 Zea mays mRNA for homeodomain transcription factor (prs gene). | |||
GenBank | BT066120 | 2e-79 | BT066120.1 Zea mays full-length cDNA clone ZM_BFb0350F05 mRNA, complete cds. | |||
GenBank | JX469942 | 2e-79 | JX469942.1 Zea mays subsp. mays clone UT3202 HB-type transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015692532.1 | 8e-49 | PREDICTED: WUSCHEL-related homeobox 3-like | ||||
Swissprot | Q6S3I3 | 3e-39 | WOX3B_MAIZE; WUSCHEL-related homeobox 3B | ||||
Swissprot | Q70UV1 | 3e-39 | WOX3A_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | M0TXB8 | 3e-43 | M0TXB8_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr9P04090_001 | 6e-44 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2177 | 38 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28610.1 | 1e-35 | WOX family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|