PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011945.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB_related
Protein Properties Length: 412aa    MW: 45448.6 Da    PI: 6.3459
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011945.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.58.2e-101445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g W++eEde+l + ++++G g+W+++++  g
       Do011945.1 14 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAG 45
                     678*************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-14643IPR009057Homeodomain-like
PROSITE profilePS5129412.764998IPR017930Myb domain
SuperFamilySSF466893.71E-121290IPR009057Homeodomain-like
SMARTSM007173.2E-101396IPR001005SANT/Myb domain
PfamPF002494.6E-71445IPR001005SANT/Myb domain
CDDcd001673.64E-71791No hitNo description
Gene3DG3DSA:1.10.10.601.0E-1169111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSV PKLAGMYKEF FCTWSFSIIN  60
SQPFPFSMRR WSQIAAQLPG RTDNEIKNLW NSCIKKKLRQ KGIDPNTHKP LAEADRSGAA  120
PTISTERTSG SSDVNPSSTG ALGNLGHLLS ETAQSSMLLP VYDKNQPETP NLARPKVPPK  180
ELFLDQLTAG HESPSTCRSS GQTLYFPFQQ PLGYSSESGS GDGASMNSLW FNQNDFNCST  240
ISTVMPPVSP SALSTSMGLN LPPDNPRHGG TGIGSVSVDS FYWDGTNPSS SSSTGSRGSN  300
SLGFEPQSTS SILENSVFPW TDIGQGKDTR AHLVEELKWP DLLHGTFAET TIAMQNQSQS  360
LYDDVIKAES QFNMEGICAS WYQNQQPQQQ LQAAPDMYDK DLQRMQLSFE NI
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo011945.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5464030.0HF546403.1 Saccharum barberi myb18 gene for MYB18 transcription factor, exons 1-4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960435.10.0transcription factor MYB61 isoform X1
TrEMBLA0A1E5VFV20.0A0A1E5VFV2_9POAL; Transcription factor MYB86
STRINGSi022112m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.14e-51myb domain protein 61