PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do011589.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 119aa MW: 13158 Da PI: 7.5547 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 31.1 | 7.8e-10 | 4 | 27 | 2 | 25 |
YABBY 2 dvfssseqvCyvqCnfCntilavs 25 ++ ++++vCyv+CnfCnt+lav Do011589.1 4 QIAPAADHVCYVHCNFCNTVLAVR 27 567899****************95 PP | |||||||
2 | YABBY | 74.6 | 3.3e-23 | 55 | 91 | 134 | 170 |
YABBY 134 keeiqrikasnPdishreafsaaaknWahfPkihfgl 170 eei+rika+nPdishreafs+aaknWah+P+ihfgl Do011589.1 55 WEEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGL 91 59*********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 6.6E-7 | 9 | 27 | IPR006780 | YABBY protein |
Pfam | PF04690 | 2.9E-21 | 56 | 91 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MSAQIAPAAD HVCYVHCNFC NTVLAVRSIY MLPAYDLSSY ISLSLVQLSL SLSLWEEIRR 60 IKANNPDISH REAFSTAAKN WAHYPNIHFG LSPGREGGNK LVDEAVSPTP APQKIQGLY |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do011589.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT060529 | 2e-35 | BT060529.1 Zea mays full-length cDNA clone ZM_BFb0012C02 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025804907.1 | 1e-37 | protein YABBY 6-like isoform X1 | ||||
Refseq | XP_025804908.1 | 9e-38 | protein YABBY 6-like isoform X2 | ||||
Swissprot | Q2QM17 | 3e-31 | YAB6_ORYSJ; Protein YABBY 6 | ||||
TrEMBL | A0A1E5W2R3 | 1e-83 | A0A1E5W2R3_9POAL; Protein YABBY 6 | ||||
STRING | OMERI12G13400.1 | 8e-38 | (Oryza meridionalis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1394 | 37 | 121 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 9e-20 | YABBY family protein |