PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV58725.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 210aa MW: 23733.4 Da PI: 6.9357 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.6 | 6e-18 | 29 | 74 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd +l +v+++G ++W++I++++ gR++k+c++rw + KZV58725.1 29 KGPWSAEEDMILTSLVERYGARNWSLISKYIK-GRSGKSCRLRWCNQ 74 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 55.7 | 1.1e-17 | 83 | 125 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++ Ede+++ a++q+G++ W+ Iar ++ gRt++ +k++w++ KZV58725.1 83 PFSEAEDEIILAAHEQYGNR-WAMIARLLP-GRTDNAVKNHWNST 125 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.233 | 24 | 75 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.75E-32 | 27 | 122 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-15 | 28 | 77 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-17 | 29 | 74 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-25 | 30 | 82 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.01E-14 | 31 | 73 | No hit | No description |
PROSITE profile | PS51294 | 23.886 | 76 | 130 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-15 | 80 | 128 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-14 | 83 | 125 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.19E-12 | 83 | 126 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-22 | 83 | 129 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MDIFNRCSPA SSSSTDSFEN ETPTTERIKG PWSAEEDMIL TSLVERYGAR NWSLISKYIK 60 GRSGKSCRLR WCNQLSPNVE HSPFSEAEDE IILAAHEQYG NRWAMIARLL PGRTDNAVKN 120 HWNSTLGRRY QQQQTQKQGA GEQRDTKKNV NDFDENDPMT ALTLAPPGMI GGGGGTPEFW 180 DGMRKVIARE VRHYVTSSFP ESSGMGFQYF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-42 | 28 | 129 | 6 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV58725.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011083803.1 | 1e-93 | transcription factor MYB44-like | ||||
Swissprot | Q9SN12 | 7e-50 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A2Z7DFK1 | 1e-157 | A0A2Z7DFK1_9LAMI; Uncharacterized protein | ||||
STRING | Aquca_007_00580.1 | 8e-80 | (Aquilegia coerulea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7950 | 21 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 2e-51 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|