PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV24998.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 180aa MW: 21412.7 Da PI: 6.1163 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 49.5 | 9e-16 | 88 | 138 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +++rr+++NRe+ArrsR RK+ ++eL v L +eN++L+++l++ ++ KZV24998.1 88 RKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLNHVSED 138 689******************************************998876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.9E-14 | 84 | 148 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.737 | 86 | 149 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.1E-13 | 88 | 138 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.3E-11 | 88 | 160 | No hit | No description |
SuperFamily | SSF57959 | 9.38E-14 | 88 | 138 | No hit | No description |
CDD | cd14702 | 2.59E-17 | 89 | 140 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 91 | 106 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MQQGELLSEL EYLFHRNSTC FHPYSSYMIN NNNMAPAHDH LHTFSNPLHQ LNISPQVREF 60 NPQSACLSSN NSTSDEAEEQ QFSIINERKQ RRMISNRESA RRSRMRKQRH LDELWSQVVW 120 LRNENHQLID KLNHVSEDHD RVVQENVQLK EETSELRRMI TDMQLSSPYS SLIEELHDDI |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 100 | 107 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV24998.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011099071.1 | 1e-74 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 2e-46 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A2Z7AUF0 | 1e-129 | A0A2Z7AUF0_9LAMI; Basic leucine zipper 43 | ||||
STRING | XP_010694542.1 | 1e-70 | (Beta vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA947 | 24 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 3e-58 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|