PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV21014.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 168aa MW: 19820.2 Da PI: 6.7251 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46.7 | 6.7e-15 | 73 | 121 | 5 | 53 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 +++rr+++NRe+ArrsR RK++ ++eL v L +eN L ++l+ + KZV21014.1 73 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENGHLMDRLNDFS 121 689***************************************9888765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.5E-14 | 69 | 133 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.565 | 71 | 134 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 8.8E-13 | 73 | 122 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.57E-13 | 73 | 122 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.8E-12 | 73 | 145 | No hit | No description |
CDD | cd14702 | 1.35E-19 | 74 | 125 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 76 | 91 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MQSSDFSELR YPLFPQLPSQ FPPQFPLAGI SPPPYHHLST PYLIQELSPQ QVTCSNSTSD 60 EADEQQVSII NERKQRRMIS NRESARRSRM RKQKHLDELW SQVVWLRNEN GHLMDRLNDF 120 SDRHDRVVQE NSQLKEEASE LRRMIVHMQI NSPFQGFTDL DHDHPSIK |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 85 | 92 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV21014.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011099071.1 | 2e-64 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 6e-40 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A2Z7AH27 | 1e-120 | A0A2Z7AH27_9LAMI; Ocs element-binding factor 1-like | ||||
STRING | Migut.H00570.1.p | 6e-63 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA947 | 24 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 7e-50 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|