PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV13853.1
Organism
Dorcoceras hygrometricum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family NAC
Protein Properties Length: 68aa    MW: 7967.96 Da    PI: 10.2359
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV13853.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.25.8e-1814583128
         NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 Wkat  d+++ + ++e +glkktLvfy+g+ap+g+kt+W+mhey+l
  KZV13853.1   1 WKATVADQRIQE-RQEIIGLKKTLVFYHGKAPNGKKTNWIMHEYTL 45 
                 ***********9.999****************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF023655.1E-8145IPR003441NAC domain
PROSITE profilePS5100520.371166IPR003441NAC domain
SuperFamilySSF1019411.7E-16152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
WKATVADQRI QERQEIIGLK KTLVFYHGKA PNGKKTNWIM HEYTLRQRST CNDANNNMQV  60
NNYSNSVN
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', and to the tracheary elements (TE) specific regulating cis-element (TERE), 5'-CTTNAAAGCNA-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20952636, PubMed:20488898). Involved in xylem formation in roots and shoots, especially regulating metaxylem vessel differentiation by promoting immature xylem vessel-specific genes expression, especially genes regulating programmed cell death (PCD) and secondary wall formation in tracheary elements (TE) (PubMed:16103214, PubMed:20952636, PubMed:20488898). Can activate MYB25, MYB46, MYB58, MYB63, MYB83, MYB103, CESA4, LBD15, LBD30, ERF115, XCP1, XCP2, NAC010/SND3, KNAT7, ASL19 and ASL20 expression (PubMed:17890373, PubMed:18952777, PubMed:19088331, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:20952636). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:20952636}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV13853.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002976911.14e-15NAC domain-containing protein 105
RefseqXP_002980632.24e-15NAC domain-containing protein 105
RefseqXP_018842746.14e-15PREDICTED: NAC domain-containing protein 62-like
SwissprotQ9LVA14e-15NC101_ARATH; NAC domain-containing protein 101
TrEMBLA0A2Z6ZYF58e-44A0A2Z6ZYF5_9LAMI; NAC domain-containing protein 100-like (Fragment)
STRINGEFJ182836e-15(Selaginella moellendorffii)
STRINGEFJ220211e-14(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62380.17e-17NAC-domain protein 101
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]