PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G62380.1
Common NameANAC101, MMI9.21, NAC101, VND6
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 348aa    MW: 39729.8 Da    PI: 5.0129
Description NAC-domain protein 101
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G62380.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.72.6e-5481362129
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  ppG+rFhPtdeelv++yLk+kv+   +++ +vik+vd+yk+ePwd+++   + ++ee+ewyfFs++dkky+tg+r+nrat sg+Wkatg+dk+++s k
  AT5G62380.1   8 PPGYRFHPTDEELVDYYLKNKVAFPGMQV-DVIKDVDLYKIEPWDIQElcgRGTGEEREWYFFSHKDKKYPTGTRTNRATGSGFWKATGRDKAIYS-K 103
                  9****************************.99**************954555555788**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                  +elvg++ktLvfykgrap+g+k+dW+mheyrle
  AT5G62380.1 104 QELVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                  99*****************************85 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.19E-605156IPR003441NAC domain
PROSITE profilePS5100558.2887156IPR003441NAC domain
PfamPF023654.2E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0009620Biological Processresponse to fungus
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0010981Biological Processregulation of cell wall macromolecule metabolic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0071555Biological Processcell wall organization
GO:0090058Biological Processmetaxylem development
GO:0005634Cellular Componentnucleus
GO:0009531Cellular Componentsecondary cell wall
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000039anatomyshoot axis vascular system
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0000372anatomymetaxylem
PO:0003011anatomyroot vascular system
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MESLAHIPPG YRFHPTDEEL VDYYLKNKVA FPGMQVDVIK DVDLYKIEPW DIQELCGRGT  60
GEEREWYFFS HKDKKYPTGT RTNRATGSGF WKATGRDKAI YSKQELVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GPPHEEGWVV CRAFKKKLTT MNYNNPRTMM GSSSGQESNW  180
FTQQMDVGNG NYYHLPDLES PRMFQGSSSS SLSSLHQNDQ DPYGVVLSTI NATPTTIMQR  240
DDGHVITNDD DHMIMMNTST GDHHQSGLLV NDDHNDQVMD WQTLDKFVAS QLIMSQEEEE  300
VNKDPSDNSS NETFHHLSEE QAATMVSMNA SSSSSPCSFY SWAQNTHT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50215710169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184245810.0
Genevisible247479_at0.0
Expression AtlasAT5G62380-
AtGenExpressAT5G62380-
ATTED-IIAT5G62380-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem, especially newly proliferating cells derived presumably from pericycle. {ECO:0000269|PubMed:16103214}.
UniprotTISSUE SPECIFICITY: Expressed in root inner metaxylem vessels and in hypocotyl vessels (PubMed:18445131, PubMed:18952777). Present in root developing xylems (PubMed:16103214). Accumulates in the xylem but not in interfascicular fibers or pith cells in inflorescence stems. Absent from secondary xylem in roots (PubMed:18952777). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC-domain transcription factor involved in xylem formation. Induces transdifferentiation of various cells into metaxylem vessel elements. Located in the nucleus. Expression induced in the presence of auxin, cytokinin and brassinosteroids.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', and to the tracheary elements (TE) specific regulating cis-element (TERE), 5'-CTTNAAAGCNA-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20952636, PubMed:20488898). Involved in xylem formation in roots and shoots, especially regulating metaxylem vessel differentiation by promoting immature xylem vessel-specific genes expression, especially genes regulating programmed cell death (PCD) and secondary wall formation in tracheary elements (TE) (PubMed:16103214, PubMed:20952636, PubMed:20488898). Can activate MYB25, MYB46, MYB58, MYB63, MYB83, MYB103, CESA4, LBD15, LBD30, ERF115, XCP1, XCP2, NAC010/SND3, KNAT7, ASL19 and ASL20 expression (PubMed:17890373, PubMed:18952777, PubMed:19088331, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:20952636). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:20952636}.
Function -- GeneRIF ? help Back to Top
  1. Transcription switch for plant metaxylem and protoxylem vessel formation [Vnd6] [VASCULAR-RELATED NAC-DOMAIN6 ]
    [PMID: 16103214]
  2. VASCULAR-RELATED NAC-DOMAIN PROTEIN6 (VND6) and VND7, which are transcription factors required for TE differentiation, determine ASL19 and ASL20 expression in immature tracheary elements (TEs).
    [PMID: 19088331]
  3. A glucocorticoid-mediated posttranslational induction system of VND6 and VND7, is reported.
    [PMID: 20488898]
  4. VND6 controls genes downstream that are involved in programmed cell death.
    [PMID: 20952636]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00578DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G62380.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G16490(A), AT1G28470(A), AT1G62990(A), AT1G79180(A), AT5G12870(A), AT5G56110(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, brassinosteroid, cytokinin
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9LVA1
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Defects in metaxylem vessel formation in seedling roots. {ECO:0000269|PubMed:16103214}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G62380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0265100.0BT026510.1 Arabidopsis thaliana At5g62380 mRNA, complete cds.
GenBankDQ0567340.0DQ056734.1 Arabidopsis thaliana no apical meristem family protein (At5g62380) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001318864.10.0NAC-domain protein 101
RefseqNP_201044.10.0NAC-domain protein 101
SwissprotQ9LVA10.0NC101_ARATH; NAC domain-containing protein 101
TrEMBLA0A178UFI90.0A0A178UFI9_ARATH; VND6
STRINGAT5G62380.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122481732
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kubo M, et al.
    Transcription switches for protoxylem and metaxylem vessel formation.
    Genes Dev., 2005. 19(16): p. 1855-60
    [PMID:16103214]
  4. Mitsuda N,Seki M,Shinozaki K,Ohme-Takagi M
    The NAC transcription factors NST1 and NST2 of Arabidopsis regulate secondary wall thickenings and are required for anther dehiscence.
    Plant Cell, 2005. 17(11): p. 2993-3006
    [PMID:16214898]
  5. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  6. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  7. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  8. Zhong R,Richardson EA,Ye ZH
    The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2776-92
    [PMID:17890373]
  9. Yamaguchi M,Kubo M,Fukuda H,Demura T
    Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots.
    Plant J., 2008. 55(4): p. 652-64
    [PMID:18445131]
  10. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  11. Soyano T,Thitamadee S,Machida Y,Chua NH
    ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.
    Plant Cell, 2008. 20(12): p. 3359-73
    [PMID:19088331]
  12. Zhou J,Lee C,Zhong R,Ye ZH
    MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.
    Plant Cell, 2009. 21(1): p. 248-66
    [PMID:19122102]
  13. McCarthy RL,Zhong R,Ye ZH
    MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2009. 50(11): p. 1950-64
    [PMID:19808805]
  14. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  15. Yamaguchi M, et al.
    VASCULAR-RELATED NAC-DOMAIN6 and VASCULAR-RELATED NAC-DOMAIN7 effectively induce transdifferentiation into xylem vessel elements under control of an induction system.
    Plant Physiol., 2010. 153(3): p. 906-14
    [PMID:20488898]
  16. Zhong R,Lee C,Ye ZH
    Global analysis of direct targets of secondary wall NAC master switches in Arabidopsis.
    Mol Plant, 2010. 3(6): p. 1087-103
    [PMID:20935069]
  17. Ohashi-Ito K,Oda Y,Fukuda H
    Arabidopsis VASCULAR-RELATED NAC-DOMAIN6 directly regulates the genes that govern programmed cell death and secondary wall formation during xylem differentiation.
    Plant Cell, 2010. 22(10): p. 3461-73
    [PMID:20952636]
  18. McCarthy RL,Zhong R,Ye ZH
    Secondary wall NAC binding element (SNBE), a key cis-acting element required for target gene activation by secondary wall NAC master switches.
    Plant Signal Behav, 2011. 6(9): p. 1282-5
    [PMID:21847026]
  19. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  20. Reusche M, et al.
    Verticillium infection triggers VASCULAR-RELATED NAC DOMAIN7-dependent de novo xylem formation and enhances drought tolerance in Arabidopsis.
    Plant Cell, 2012. 24(9): p. 3823-37
    [PMID:23023171]
  21. Yang F, et al.
    Engineering secondary cell wall deposition in plants.
    Plant Biotechnol. J., 2013. 11(3): p. 325-35
    [PMID:23140549]
  22. Petersen PD, et al.
    Engineering of plants with improved properties as biofuels feedstocks by vessel-specific complementation of xylan biosynthesis mutants.
    Biotechnol Biofuels, 2012. 5(1): p. 84
    [PMID:23181474]
  23. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  24. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]