PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca899.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 165aa MW: 19369.8 Da PI: 10.4991 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 101.1 | 1.1e-31 | 40 | 96 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RR +Rakle+ +kl k+rkpylheSRh+hA++R+Rg+gGrF Dca899.1 40 EEPVYVNAKQYRGILRRRLHRAKLEALNKL-VKNRKPYLHESRHQHAVKRARGTGGRF 96 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.8E-34 | 38 | 99 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 34.945 | 39 | 99 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.4E-27 | 41 | 96 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.3E-22 | 42 | 64 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 44 | 64 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.3E-22 | 73 | 96 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MSFYYPVIGY LPMRHFDRLN SQVTGTTPAR VPLPLEVPTE EPVYVNAKQY RGILRRRLHR 60 AKLEALNKLV KNRKPYLHES RHQHAVKRAR GTGGRFLNKK AVQSSNSFHE SEVRQQEHHR 120 QRISSASVFD ATSMSTSDEI YRPTEFRFYE YTSRVEETGD QNYGR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-19 | 39 | 104 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021720491.1 | 2e-52 | nuclear transcription factor Y subunit A-3-like | ||||
Refseq | XP_021720492.1 | 2e-52 | nuclear transcription factor Y subunit A-3-like | ||||
Swissprot | Q93ZH2 | 3e-34 | NFYA3_ARATH; Nuclear transcription factor Y subunit A-3 | ||||
TrEMBL | A0A2I7ZAT7 | 6e-48 | A0A2I7ZAT7_SESPO; Nuclear factor Y subunit A8 | ||||
STRING | XP_010685336.1 | 1e-48 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54160.1 | 6e-28 | nuclear factor Y, subunit A5 |