PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca55188.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 105aa MW: 11943.4 Da PI: 10.2753 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 132.1 | 7.1e-41 | 18 | 76 | 112 | 170 |
YABBY 112 vppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 v+rPPekrqrvPsayn+fikeeiqrika+nP+ishreafs+aaknWahfP+ihfgl Dca55188.1 18 ERVVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGL 76 3459*****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 5.8E-39 | 13 | 76 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.83E-8 | 16 | 69 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 5.7E-5 | 23 | 70 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MASSRSPSPS VTNISTEERV VNRPPEKRQR VPSAYNQFIK EEIQRIKANN PEISHREAFS 60 TAAKNWAHFP HIHFGLMLET NNNHANKLDE GTQKQLPTTA LLNNL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021760782.1 | 5e-52 | axial regulator YABBY 5-like isoform X1 | ||||
Swissprot | Q8GW46 | 4e-43 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A0K9QZA0 | 3e-50 | A0A0K9QZA0_SPIOL; Uncharacterized protein | ||||
STRING | XP_010687959.1 | 2e-49 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 2e-45 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|