PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca30092.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 106aa MW: 11902.1 Da PI: 8.0715 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132.4 | 1.6e-41 | 19 | 95 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cq+++C+adl++ak+yhrrhkvCe+h+kapvv+v+g +qrfCqqCsrfhe+ efD++krsCr+rLa+hn+rrrk + Dca30092.1 19 CCQADNCTADLTDAKRYHRRHKVCEFHAKAPVVIVQGYHQRFCQQCSRFHEVMEFDDTKRSCRNRLAGHNARRRKGS 95 6*************************************************************************965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 6.6E-34 | 13 | 81 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.077 | 17 | 94 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.75E-38 | 18 | 98 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.7E-32 | 20 | 93 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MDGDDNDQGG AGSNNTIVCC QADNCTADLT DAKRYHRRHK VCEFHAKAPV VIVQGYHQRF 60 CQQCSRFHEV MEFDDTKRSC RNRLAGHNAR RRKGSFDAQA PGETSG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-35 | 10 | 93 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021726481.1 | 2e-46 | squamosa promoter-binding protein 1-like isoform X2 | ||||
Swissprot | Q38741 | 8e-40 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A0K9R2V1 | 9e-46 | A0A0K9R2V1_SPIOL; Uncharacterized protein | ||||
STRING | cassava4.1_018710m | 7e-44 | (Manihot esculenta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 4e-40 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|