PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Dca1281.1

Organism

Dianthus caryophyllus

Taxonomic ID

3570

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus

Family

MYB_related

Protein Properties

Length: 105aa MW: 12218.7 Da PI: 8.7666

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Dca1281.1	genome	DCA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.8	6.9e-20	31	78	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd+ l+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl Dca1281.1 31 RGPWTVEEDLALINYITTHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 78 89*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.827	26	82	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-22	26	81	IPR009057	Homeodomain-like
SMART	SM00717	1.5E-15	30	80	IPR001005	SANT/Myb domain
Pfam	PF00249	4.3E-17	31	78	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.99E-23	32	105	IPR009057	Homeodomain-like
CDD	cd00167	1.29E-11	33	78	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.6E-6	82	105	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MNINNIRSSS SSSDNKSEIT QNSDDEMDLR RGPWTVEEDL ALINYITTHG EGRWNSLARC 60 AGLKRTGKSC RLRWLNYLRP DVRRGNITLE EQLMILELHS RWGNR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-15	28	105	24	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019180052.1	7e-52	PREDICTED: transcription factor MYB108-like
Swissprot	Q10MB4	3e-45	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A067FXC2	7e-50	A0A067FXC2_CITSI; Uncharacterized protein
TrEMBL	A0A2H3X916	3e-50	A0A2H3X916_PHODC; transcription factor MYB78-like
TrEMBL	A0A2H5N758	6e-50	A0A2H5N758_CITUN; Uncharacterized protein
TrEMBL	V4TZV4	7e-50	V4TZV4_9ROSI; Uncharacterized protein
STRING	XP_006488792.1	1e-50	(Citrus sinensis)
STRING	XP_008780184.1	5e-51	(Phoenix dactylifera)
STRING	XP_006419304.1	1e-50	(Citrus clementina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27810.1	2e-45	myb domain protein 21

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]