PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_015927 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 178aa MW: 20116.1 Da PI: 7.5017 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 186.2 | 2.3e-57 | 5 | 176 | 197 | 374 |
GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294 + gEal +n+v +l+r++ + sl ++L ++++ sP++v+++eqe++hn++ Fl rfl+al+yysa+fdsl+a++p +s +r+kvE+ + ei DCAR_015927 5 RVGEALTINSVNRLQRVP--RNSL----GSLLAMIRDQSPNIVTIAEQETSHNGPYFLGRFLKALHYYSAIFDSLDATFPLDSAHRVKVEQYISTLEI 96 459**************9..4444....45******************************************************************** PP GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 +n+vace er++rhe+lekWr+ +e+ GF+ vpls +a++q + ll ++ dgy++ e++g+l+lgW+drp++++ aWr DCAR_015927 97 QNIVACEVPERVMRHEKLEKWRKIMESKGFEGVPLSANAVTQSNILLGLYSCDGYSLTEDHGCLLLGWQDRPILAAYAWR 176 *******************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 26.162 | 1 | 156 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 7.7E-55 | 5 | 176 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MFNRRVGEAL TINSVNRLQR VPRNSLGSLL AMIRDQSPNI VTIAEQETSH NGPYFLGRFL 60 KALHYYSAIF DSLDATFPLD SAHRVKVEQY ISTLEIQNIV ACEVPERVMR HEKLEKWRKI 120 MESKGFEGVP LSANAVTQSN ILLGLYSCDG YSLTEDHGCL LLGWQDRPIL AAYAWRC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3h_A | 6e-39 | 2 | 175 | 206 | 377 | Protein SCARECROW |
5b3h_D | 6e-39 | 2 | 175 | 206 | 377 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that functions in mycorrhizal specific signaling (PubMed:23122845). Required for Myc factor signaling from mycorrhizal fungi, but has no function in Nod factor signaling from rhizobial bacteria (PubMed:23122845). Regulates the expression of RAM2, a glycerol-3-phosphate acyl transferase that promotes cutin biosynthesis to enhance mycorrhizal hyphopodia formation (PubMed:23122845). {ECO:0000269|PubMed:23122845}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced in roots during colonization by arbuscular mycorrhizal fungi. {ECO:0000269|PubMed:23122845}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017245655.1 | 1e-108 | PREDICTED: DELLA protein RGL1-like | ||||
Swissprot | G7L166 | 1e-100 | RAM1_MEDTR; GRAS family protein RAM1 | ||||
TrEMBL | A0A165A0D3 | 1e-130 | A0A165A0D3_DAUCS; Uncharacterized protein | ||||
STRING | XP_006470106.1 | 1e-100 | (Citrus sinensis) | ||||
STRING | XP_006447014.1 | 1e-100 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12566 | 19 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G03450.1 | 8e-45 | RGA-like 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_015927 |
Publications ? help Back to Top | |||
---|---|---|---|
|