PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009674
Organism
Daucus carota
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GATA
Protein Properties Length: 91aa    MW: 10313.8 Da    PI: 10.1971
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009674genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-182054135
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                 C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  DCAR_009674 20 CTHCLSQKTPQWRAGPLGPKTLCNACGVRYKSGRL 54
                 *******************************9986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.1631450IPR000679Zinc finger, GATA-type
SMARTSM004014.1E-161468IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.81E-161577No hitNo description
Gene3DG3DSA:3.30.50.101.0E-141752IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.92E-121966No hitNo description
PfamPF003202.0E-162054IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402045IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MMEIQEESLE DRNGQQGRRC THCLSQKTPQ WRAGPLGPKT LCNACGVRYK SGRLLPEYRP  60
AKSPTFVSYK HSNSHKKVLE MRTMSHLSSH *
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017241021.13e-61PREDICTED: GATA transcription factor 5-like
SwissprotO497414e-36GATA2_ARATH; GATA transcription factor 2
SwissprotO497432e-36GATA4_ARATH; GATA transcription factor 4
SwissprotO826326e-36GATA9_ARATH; GATA transcription factor 9
SwissprotP697819e-36GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A166A9U13e-61A0A166A9U1_DAUCS; Uncharacterized protein
STRINGXP_008812058.13e-43(Phoenix dactylifera)
STRINGXP_010257696.13e-43(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1515558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-38GATA transcription factor 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]
  3. Jiang K,Yung V,Chiba T,Feldman LJ
    Longitudinal patterning in roots: a GATA2-auxin interaction underlies and maintains the root transition domain.
    Planta, 2018. 247(4): p. 831-843
    [PMID:29249045]