PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g047269m | ||||||||
Common Name | CISIN_1g047269mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 218aa MW: 25367.7 Da PI: 7.9653 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.2 | 5.9e-16 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l+++++ +G g+W++I + g++R++k+c++rw++yl orange1.1g047269m 9 KGLWTQEEDRILLEYIRVHGRGQWNRIHKVTGLKRCGKSCRLRWLNYL 56 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 59.3 | 8.8e-19 | 63 | 107 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g +T+eE+ l+++++++lG++ W++Ia +++ gRt++q+k++w+++l orange1.1g047269m 63 GEFTEEEENLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 107 78*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.322 | 4 | 56 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.01E-30 | 7 | 103 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-14 | 8 | 58 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.6E-15 | 9 | 56 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.0E-23 | 10 | 63 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.43E-11 | 12 | 56 | No hit | No description |
PROSITE profile | PS51294 | 26.807 | 57 | 111 | IPR017930 | Myb domain |
SMART | SM00717 | 6.0E-16 | 61 | 109 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-17 | 63 | 107 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.96E-12 | 64 | 107 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.0E-26 | 64 | 111 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0090377 | Biological Process | seed trichome initiation | ||||
GO:0090378 | Biological Process | seed trichome elongation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MKAENEYKKG LWTQEEDRIL LEYIRVHGRG QWNRIHKVTG LKRCGKSCRL RWLNYLSPNV 60 KHGEFTEEEE NLIIRLHNLL GNRWSLIAGR VPGRTDNQVK NHWNTHLCKK LGINKKQKKK 120 FVSSSKTQAQ TQSSRIIKDD NGLTHDNLNF EHLQDSEMAL DQEPGDRKKS NEEAESINHH 180 CNESLLLPTE DDFLNLCSPI LLEFLEGQPL DLIWHNN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-28 | 9 | 111 | 7 | 108 | B-MYB |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 108 | 119 | KKLGINKKQKKK |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006483851.1 | 1e-159 | transcription factor WER-like isoform X1 | ||||
Swissprot | Q9SEI0 | 4e-64 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A067GS08 | 1e-158 | A0A067GS08_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A2H5N9S9 | 1e-157 | A0A2H5N9S9_CITUN; Uncharacterized protein | ||||
STRING | XP_006483851.1 | 1e-158 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 7e-61 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g047269m |