PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g039886m | ||||||||
Common Name | CISIN_1g039886mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 192aa MW: 22276.7 Da PI: 8.0518 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 96.8 | 3.4e-30 | 7 | 81 | 53 | 128 |
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++eke yfF++rd+ky++g+r+nra+ +gyWkatg dk++++ +g++vg kktLvfy+g+ pkg kt W+mheyr+ orange1.1g039886m 7 EKEKEFYFFTPRDRKYKNGTRPNRAAGEGYWKATGADKSIKH-NGAVVGFKKTLVFYEGKPPKGDKTFWIMHEYRV 81 568899************************************.999****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 38.879 | 1 | 110 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.01E-37 | 6 | 110 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-13 | 12 | 81 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MYKGCAEKEK EFYFFTPRDR KYKNGTRPNR AAGEGYWKAT GADKSIKHNG AVVGFKKTLV 60 FYEGKPPKGD KTFWIMHEYR VNNDSPPSTR TRLSTDMRLD DWVLCRIYYK ERSDKSLKSL 120 HRTEDRASTE ETNEPDCDKG SAVDFSGYAD TYSGYMQHLW QQQNAFSQIP SFKDVSFDSI 180 VNLDEPFQHD GT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-39 | 9 | 113 | 70 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-39 | 9 | 113 | 70 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-39 | 9 | 113 | 70 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-39 | 9 | 113 | 70 | 168 | NO APICAL MERISTEM PROTEIN |
4dul_A | 2e-39 | 9 | 113 | 70 | 168 | NAC domain-containing protein 19 |
4dul_B | 2e-39 | 9 | 113 | 70 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006446143.1 | 1e-143 | NAC transcription factor 29 | ||||
Refseq | XP_015383322.1 | 1e-143 | NAC transcription factor 29-like | ||||
Swissprot | K4BNG7 | 1e-42 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
TrEMBL | A0A067F1I4 | 1e-143 | A0A067F1I4_CITSI; Uncharacterized protein (Fragment) | ||||
TrEMBL | A0A2H5P417 | 1e-142 | A0A2H5P417_CITUN; Uncharacterized protein | ||||
TrEMBL | V4TG88 | 1e-142 | V4TG88_9ROSI; Uncharacterized protein | ||||
STRING | XP_006446143.1 | 1e-142 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM17542 | 3 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-41 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g039886m |
Publications ? help Back to Top | |||
---|---|---|---|
|