PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

orange1.1g039144m

Common Name

CISIN_1g039144mg

Organism

Citrus sinensis

Taxonomic ID

2711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

WOX

Protein Properties

Length: 209aa MW: 24042.6 Da PI: 9.9105

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g039144m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	65.6	6.6e-21	7	66	3	57
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++t+eql +Lee++++ r+p+a+++++++++l +++ ++V++WFqN++a+e++ orange1.1g039144m 7 TRWCPTPEQLMILEEMYRSgVRTPNASQIQHITAHLshfgKIEGKNVFYWFQNHKARERQ 66 8***************99************************************97 PP
2	Wus_type_Homeobox	121.6	3.2e-39	6	67	3	64
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 +tRW+PtpeQ++iLee+y+sG+rtPn+++iq+ita+L+++Gkie+kNVfyWFQN+kaRerqk orange1.1g039144m 6 STRWCPTPEQLMILEEMYRSGVRTPNASQIQHITAHLSHFGKIEGKNVFYWFQNHKARERQK 67 79***********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	10.042	2	67	IPR001356	Homeobox domain
SMART	SM00389	5.6E-5	4	71	IPR001356	Homeobox domain
CDD	cd00086	2.17E-4	7	67	No hit	No description
SuperFamily	SSF46689	1.41E-11	7	67	IPR009057	Homeodomain-like
Pfam	PF00046	1.6E-18	7	66	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	1.0E-7	8	66	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0008283	Biological Process	cell proliferation
GO:0009908	Biological Process	flower development
GO:0009943	Biological Process	adaxial/abaxial axis specification
GO:0009947	Biological Process	centrolateral axis specification
GO:0010865	Biological Process	stipule development
GO:0048513	Biological Process	animal organ development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 209 aa Download sequence Send to blast
MSPAGSTRWC PTPEQLMILE EMYRSGVRTP NASQIQHITA HLSHFGKIEG KNVFYWFQNH 60 KARERQKLRR KLGKQLQLQQ QQQIFQHHHH LQQCCQVPNH HQQLLHCSFQ SPPAGGSFSN 120 PAKVLTQGML TEDASTKTMS YTWKKGIQER VEMEKSLMGM YGRDWKMMVD VAPRSLQPCC 180 SKPPLRTLEL FPITATNLKE ECNSSKQN*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First expressed in the L1 cells of the lateral regions of a flower primordium at early stage 1, in which the lateral sepals are expected to develop at a later stage. It then rapidly decreases at the late stage 1 and disappears at stage 2. At stage 3, it reappears in all four-sepal young primordia. Not detected at the central zone of the inflorescence meristem and the floral meristem. In stages 4 through 6, when four sepals develop to enclose the flower bud, it is localized at the lateral edges of the four sepals and forms an arch of the L1 cells at the margin of sepals. Expressed in the young primordia of petals and stamens. As the petals and stamens develop, it is limited at the margins of petals and stamens in a way similar to that of sepals. In the vegetative phase, it is expressed at the lateral regions of young leaf primordia, as well as in flowers and floral organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:14711878}.
Uniprot	TISSUE SPECIFICITY: Expressed in aerial parts of seedlings, inflorescences and flowers at low level. Expressed in a restricted number of L1 cells at the lateral regions of flower primordia. {ECO:0000269\|PubMed:11751640}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:15169755}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006424705.1	1e-155	WUSCHEL-related homeobox 3
Swissprot	Q9SIB4	7e-49	WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBL	A0A067G072	1e-155	A0A067G072_CITSI; Uncharacterized protein
STRING	XP_006424705.1	1e-154	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7480	26	42

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G28610.1	9e-37	WOX family protein

Link Out ? help Back to Top
Phytozome	orange1.1g039144m

Publications ? help Back to Top
Chandler JW,Werr W Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] Niu L, et al. LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula. Plant J., 2015. 81(3): p. 480-92 [PMID:25492397] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Guan C, et al. Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086]