PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g033567m | ||||||||
Common Name | CISIN_1g032690mg, LOC102625492 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 117aa MW: 13307.7 Da PI: 10.3016 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 71 | 1.7e-22 | 12 | 69 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+W+KYGqK +k+ + rsY++C ++C++kk+ e +++dp+ v i+Y g H h+ orange1.1g033567m 12 EDGYEWKKYGQKFIKNIRKFRSYFKCQESSCMAKKRAEWCTSDPTNVRIVYDGVHSHT 69 7********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF118290 | 1.26E-21 | 6 | 69 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 18.728 | 6 | 71 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.3E-22 | 9 | 69 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.7E-21 | 11 | 70 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.4E-19 | 12 | 68 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MDRRVHRLVL PEDGYEWKKY GQKFIKNIRK FRSYFKCQES SCMAKKRAEW CTSDPTNVRI 60 VYDGVHSHTH HGSSPSSADQ PRRGSSNTSS NGNQYNLLTQ VFGDQSSNAP PASRRN* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006488951.1 | 4e-84 | probable WRKY transcription factor 23 | ||||
Refseq | XP_024047358.1 | 4e-84 | probable WRKY transcription factor 23 | ||||
TrEMBL | A0A067EH10 | 8e-83 | A0A067EH10_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A067EHB3 | 9e-83 | A0A067EHB3_CITSI; Uncharacterized protein | ||||
TrEMBL | V4TYX7 | 8e-83 | V4TYX7_9ROSI; Uncharacterized protein | ||||
STRING | XP_006488951.1 | 1e-83 | (Citrus sinensis) | ||||
STRING | XP_006445572.1 | 1e-83 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69310.2 | 1e-13 | WRKY DNA-binding protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g033567m |
Entrez Gene | 102625492 |