PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g031482m | ||||||||
Common Name | CISIN_1g031482mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 160aa MW: 18301.1 Da PI: 5.1038 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.1 | 2.8e-31 | 98 | 156 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ gCpvkk+ver+++dp++v++tYeg H+h+ orange1.1g031482m 98 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVDGCPVKKRVERDRDDPSYVITTYEGFHTHQ 156 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 84 | 157 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.7E-28 | 91 | 157 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.379 | 93 | 158 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.1E-36 | 98 | 157 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.9E-25 | 99 | 156 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MSNINLIPQD SPESDSAEKT NFELSEYLTF DEWFEDDQAS KLFGYVQNPV YRANEVVEPG 60 GTSTHFEGPS NSDNDSGREK KPVKERVAFK TKSDVEILDD GFKWRKYGKK MVKNSPNPRN 120 YYKCSVDGCP VKKRVERDRD DPSYVITTYE GFHTHQSNP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-24 | 88 | 155 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-24 | 88 | 155 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB573149 | 1e-114 | AB573149.1 Citrus unshiu genomic DNA, polyembryony locus, cultivar: Miyagawa wase. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006474454.1 | 1e-108 | probable WRKY transcription factor 50 isoform X1 | ||||
Refseq | XP_024033930.1 | 1e-108 | probable WRKY transcription factor 50 isoform X1 | ||||
Swissprot | Q8VWQ5 | 1e-49 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A067GDY4 | 1e-115 | A0A067GDY4_CITSI; Uncharacterized protein | ||||
TrEMBL | V4UPS5 | 1e-115 | V4UPS5_9ROSI; Uncharacterized protein | ||||
STRING | XP_006453040.1 | 1e-115 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6121 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 5e-52 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g031482m |
Publications ? help Back to Top | |||
---|---|---|---|
|