PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g030599m | ||||||||
Common Name | CISIN_1g029650mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 175aa MW: 19149.3 Da PI: 8.8206 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 75.6 | 8.1e-24 | 66 | 112 | 2 | 48 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 Cqv++C adls+ak+yhrrhkvCevh+ka+vvl+ g++qrfCqqCsr orange1.1g030599m 66 CQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCSR 112 **********************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 3.8E-24 | 58 | 112 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 20.726 | 63 | 124 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 4.32E-26 | 65 | 127 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.0E-17 | 66 | 119 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MDAKRKNKMV KVVKKEEATA AFVDSDDDDD DGGEYDLCPQ EEGDDNRNSS SKKNKGSSGG 60 SGLRSCQVDK CGADLSDAKQ YHRRHKVCEV HAKAQVVLMG GIRQRFCQQC SRRLAGHNER 120 RRKNAAESNG EGSSCKGTGT GTQLKDLVCG KLDDKGRIKI SIQENATCKH FQIR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-28 | 56 | 123 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.1691 | 1e-137 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006469892.1 | 4e-98 | squamosa promoter-binding protein 1-like | ||||
Refseq | XP_024047844.1 | 4e-98 | squamosa promoter-binding protein 1 | ||||
Swissprot | Q9S7A9 | 9e-29 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A067DH01 | 1e-123 | A0A067DH01_CITSI; Uncharacterized protein | ||||
STRING | XP_006469892.1 | 1e-97 | (Citrus sinensis) | ||||
STRING | XP_006447265.1 | 1e-97 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 7e-30 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g030599m |