PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g029650m | ||||||||
Common Name | CISIN_1g029650mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 191aa MW: 21171.6 Da PI: 8.7157 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 138.6 | 1.8e-43 | 66 | 142 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqv++C adls+ak+yhrrhkvCevh+ka+vvl+ g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a orange1.1g029650m 66 CQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKNAA 142 **************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 5.2E-35 | 58 | 127 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.565 | 63 | 140 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.53E-39 | 65 | 143 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.1E-33 | 66 | 139 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MDAKRKNKMV KVVKKEEATA AFVDSDDDDD DGGEYDLCPQ EEGDDNRNSS SKKNKGSSGG 60 SGLRSCQVDK CGADLSDAKQ YHRRHKVCEV HAKAQVVLMG GIRQRFCQQC SRFHELSEFD 120 ETKRSCRRRL AGHNERRRKN AAESNGEGSS CKGTGTGTQL KDLVCGKLDD KGRIKISIQE 180 NATCKHFQIR * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 8e-43 | 56 | 139 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.1691 | 0.0 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006469892.1 | 1e-115 | squamosa promoter-binding protein 1-like | ||||
Refseq | XP_024047844.1 | 1e-115 | squamosa promoter-binding protein 1 | ||||
Swissprot | Q9S7A9 | 1e-43 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A067DGL7 | 1e-135 | A0A067DGL7_CITSI; Uncharacterized protein | ||||
STRING | XP_006469892.1 | 1e-114 | (Citrus sinensis) | ||||
STRING | XP_006447265.1 | 1e-114 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 2e-44 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g029650m |