PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g024911m
Common NameCISIN_1g011483mg
Organism
Citrus sinensis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 261aa    MW: 28221.5 Da    PI: 6.1768
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g024911mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.33.7e-3482140159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  orange1.1g024911m  82 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHD 140
                        59********************************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-3867142IPR003657WRKY domain
SuperFamilySSF1182903.27E-3074142IPR003657WRKY domain
PROSITE profilePS5081138.14777142IPR003657WRKY domain
SMARTSM007741.2E-3982141IPR003657WRKY domain
PfamPF031061.5E-2683140IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MDSAATPENS SISVGDDDVD QGSQKSKSGG GGAGGGDDFD EDEPEAKRWK IEGESEGISA  60
PGSRTVREPR VVVQTTSDID ILDDGYRWRK YGQKVVKGNP NPRSYYKCTH PGCPVRKHVE  120
RASHDLRAVI TTYEGKHNHD VPAARGSGSR ALPDNSSNNN HNSNSNSNNN GTLPVRASAV  180
AHHPNNNSIL NPVHNLRVSS SEGQAPYTLE MLQGSGSFGF PGYGNALRSY MNEGQQQDNV  240
LSRAKEEPRD HDTFFESLLF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-3973143878Probable WRKY transcription factor 4
2lex_A3e-3973143878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.2370.0fruit| vegetative meristem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000250|UniProtKB:Q6IEQ7}.
UniprotDEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000269|PubMed:19199048}.
UniprotTISSUE SPECIFICITY: Expressed in aleurone cells. Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos. {ECO:0000250|UniProtKB:Q6IEQ7}.
UniprotTISSUE SPECIFICITY: Expressed in aleurone cells (PubMed:15618416). Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos (PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:26025535}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}.
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}.
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7089841e-110JF708984.1 Dimocarpus longan WRKY transcription factor 36-3 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431962.11e-171WRKY transcription factor WRKY24
SwissprotQ6B6R42e-75WRK24_ORYSI; WRKY transcription factor WRKY24
SwissprotQ6IEQ73e-75WRK24_ORYSJ; WRKY transcription factor WRKY24
TrEMBLA0A067DL380.0A0A067DL38_CITSI; Uncharacterized protein
TrEMBLA0A067DTD70.0A0A067DTD7_CITSI; Uncharacterized protein
STRINGXP_006431962.11e-170(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-70WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang ZL, et al.
    A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.
    Plant Mol. Biol., 2009. 70(1-2): p. 139-51
    [PMID:19199048]
  3. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]
  4. Zhang L, et al.
    Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells.
    Plant Sci., 2015. 236: p. 214-22
    [PMID:26025535]