PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.395890.1

Common Name

Csa_2G355030, LOC101205677

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

MYB

Protein Properties

Length: 291aa MW: 31804.7 Da PI: 9.575

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.395890.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.9	5.4e-19	12	57	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l+++v+ +G+++W++I++ ++ gR++k+c++rw + Cucsa.395890.1 12 KGPWSPEEDESLKRLVESYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57 79****************************.*********985 PP
2	Myb_DNA-binding	54.6	2.5e-17	66	108	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ Cucsa.395890.1 66 PFSAEEDDAIIRAHAKFGNK-WATIARLLN-GRTDNAIKNHWNST 108 89****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	27.278	7	62	IPR017930	Myb domain
SuperFamily	SSF46689	7.86E-32	9	105	IPR009057	Homeodomain-like
SMART	SM00717	6.3E-17	11	60	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-18	12	57	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.8E-26	13	65	IPR009057	Homeodomain-like
CDD	cd00167	1.38E-16	14	56	No hit	No description
SMART	SM00717	1.8E-15	63	111	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	21.403	64	113	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-23	66	112	IPR009057	Homeodomain-like
CDD	cd00167	7.93E-13	66	109	No hit	No description
Pfam	PF00249	7.9E-15	66	108	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 291 aa Download sequence Send to blast
MDSVGKNVDR IKGPWSPEED ESLKRLVESY GPRNWSLISK SIPGRSGKSC RLRWCNQLSP 60 QVEHRPFSAE EDDAIIRAHA KFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSAMGDDF 120 NDPDLHHPPK RSASLGPSPV TVASGFGLNP SSPSGSDLSD SSPPPPQPVY RPLARSSSIV 180 PSNQQQQQIV NSYDPPTSLC LSLPGSNSKS GYGSDSIPSP TRKMVQATPT AGGYGKESEL 240 FSAEFLSAMQ EMIKIEVRKY MSGIEHNGWH LHTDAIRNAV VKRMGISKID *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	2e-39	11	113	3	105	MYB PROTO-ONCOGENE PROTEIN
1h88_C	9e-39	7	113	53	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	9e-39	7	113	53	159	MYB PROTO-ONCOGENE PROTEIN
1mse_C	2e-39	11	113	3	105	C-Myb DNA-Binding Domain
1msf_C	2e-39	11	113	3	105	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC594030	0.0	KC594030.1 Cucumis melo MYB transcription factor mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004142878.1	0.0	PREDICTED: transcription factor MYB44-like
Swissprot	O23160	3e-86	MYB73_ARATH; Transcription factor MYB73
Swissprot	Q9FDW1	2e-86	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A0A0LNY0	0.0	A0A0A0LNY0_CUCSA; Uncharacterized protein
STRING	XP_004156374.1	0.0	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF843	34	124

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37260.1	1e-79	myb domain protein 73

Link Out ? help Back to Top
Phytozome	Cucsa.395890.1
Entrez Gene	101205677

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]